Recombinant Bovine Somatostatin receptor type 2(SSTR2)

Code CSB-CF022725BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34993
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MDLVSELNETQPWLTTPFDLNGSVGAANISNQTEPYYDLASNVVLTFIYFVVCIIGLCGN TLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTV DGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYA GLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIR VGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLT YANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLL NGDLQTSI
Source in vitro E.coli expression system
Gene Names SSTR2
Protein Names Recommended name: Somatostatin receptor type 2 Short name= SS-2-R Short name= SS2-R Short name= SS2R Alternative name(s): SRIF-1
Expression Region 1-368
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasm
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: bta:282083

STRING: 9913.ENSBTAP00000022785

UniGene: Bt.464

Pathway cAMP signaling pathway

Related Products

SSTR2 Proteins

SSTR2 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.