Recombinant Branchiostoma belcheri Melanopsin(OPN4)

Code CSB-CF683935BVX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4R1I4
Storage Buffer Tris-based buffer,50% glycerol
Species Branchiostoma belcheri (Amphioxus)
Sequence MTEIPSFQPPINATEVEEENAVFPTALTEWFSEVGNQVGEVALKLLSGEGDGMEVTPTPG CTGNGSVCNGTDSGGVVWDIPPLAHYIVGTAVFCIGCCGMFGNAVVVYSFIKSKGLRTPA NFFIINLALSDFLMNLTNMPIFAVNSAFQRWLLSDFACELYGFAGGLFGCLSINTLMAIS MDRYLVITKPFLVMRIVTKQRVMFAILLLWIWSLVWALPPLFGWSAYVSEGFGTSCTFDY MTPKLSYHIFTYIIFFTMYFIPGGVMIYCYYNIFATVKSGDKQFGKAVKEMAHEDVKNKA QQERQRKNEIKTAKIAFIVISLFMSAWTPYAVVSALGTLGYQDLVTPYLQSIPAMFAKSS AVYSPIVYAITYPKFREAVKKHIPCLSGCLPASEEETKTKTRGQSSASASMSMTQTTAPV HDPQASVDSGSSVSVDDSSGVSRQDTMMVKVEVDKRMEKAGGGAADAAPQEGASVSTVSA QIEVRPSGKVTTKADVISTPQTAHGLSASPVPKVAELGSSATLESAAIPGKIPTPLPSQP IAAPIERHMAAMADEPPPKPRGVATTVNVRRTESGYDRSQDSQRKKVVGDTHRSRSFNTT KDHFASEQPAALIQPKELYSDDTTKKMARQSSEKHEYDNPAFDEGITEVDTDSENETEGS YDMLSVRFQAMAEEPPVETYRKASDLAINLGKASLMLSEAHDETVL
Source in vitro E.coli expression system
Gene Names OPN4
Protein Names Recommended name: Melanopsin Alternative name(s): Opsin-4 amphi-MOP
Expression Region 1-706
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor implicated in non-image-forming responses to light. Photoisomerizes covalently bound all-trans retinal back to 11-cis retinal. Most likely coupled to the G(q) signaling cascade.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in Joseph cells and photoreceptor cells of the dorsal ocelli.

Related Products

OPN4 Proteins

OPN4 Proteins for Branchiostoma belcheri (Amphioxus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.