Recombinant Cambarus hubrichti Rhodopsin(RHO)

Code CSB-CF019681CYS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O18312
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Cambarus hubrichti (Salem cave crayfish)
Sequence LHMIHLHWYQYPPMNPMMYPLLLIFMLFTGILCLAGNFVTIWVFMNTKSLRTPANLLVVN LAMSDFLMMFTMFPPMMVTCYYHTWTLGPTFCQVYAFLGNLCGCASIWTMVFITFDRYNV IVKGVAGEPLSTKKASLWILSVWVLSTAWCIAPFFGWNHYVPEGNLTGCGTDYLSEDILS RSYLYIYSTWVYFLPLAITIYCYVFIIKAVAAHEKGMRDQAKKMGIKSLRNEEAQKTSAE CRLAKNAMTTVALWFIAWTPCLLINWVGMFARSYLSPVYTIWGYVFAKANAVYNPIVYAI S
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 1-301
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity. Can use both retinal and 3-dehydroretinal as visual pigment. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Signaling via GNAQ probably mediates the activation of phospholipase C.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily

Related Products

RHO Proteins

RHO Proteins for Cambarus hubrichti (Salem cave crayfish)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.