Recombinant Cat Kit ligand(KITLG)

Code CSB-CF012376CA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P79169
Storage Buffer Tris-based buffer,50% glycerol
Species Felis catus (Cat) (Felis silvestris catus)
Sequence KGLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
Source in vitro E.coli expression system
Gene Names KITLG
Protein Names Recommended name: Kit ligand Alternative name(s): Mast cell growth factor Short name= MGF Stem cell factor Short name= SCF c-Kit ligand Cleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG
Expression Region 26-274
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stimulates the proliferation of mast cells. Able to augment the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. Mediates also cell-cell adhesion. Acts synergistically with other cytokines, probably interleukins (By similarity).
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, Secreted
Protein Families SCF family
Database Links

KEGG: fca:493937

STRING: 9685.ENSFCAP00000020444

Pathway MAPK signaling pathway
Melanogenesis
PI3K-Akt signaling pathway
Ras signaling pathway
Fc gamma R-mediated phagocytosis
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

KITLG Proteins

KITLG Proteins for Felis catus (Cat) (Felis silvestris catus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.