Recombinant Cat Melanopsin(OPN4)

Code CSB-CF733457CA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5YKK9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Felis catus (Cat) (Felis silvestris catus)
Sequence MNPPSGPRTQEPSCVATPASPSRWDGYRSSTSSLDQPLPISPTAARAQAAAWIPFPTVDV PDHAHYTLGTVILLVGLTGILGNLMVIYTFCRSRGLRTPANMFIINLAVSDFFMSFTQAP VFFASSLHKRWLFGEAGCEFYAFCGALFGITSMITLMAIALDRYLVITHPLATIGVVSKR RAALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPSVRAYTMLLFCFVFF LPLLVIVYCYIFIFRAIRETGQALQTFRACEGGGRSPRQRQRLQREWKMAKIELLVILLF VLSWAPYSIVALMAFAGYAHVLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRMAIAQHL PCLGVLLGVSGQHTGPYASYRSTHRSTLSSQASDLSWISGRRRQASLGSESEVGWMDTEA AAVWGAAQQVSGRFPCSQGLEDREAKAPVRPQGREAETPGQAMTMAMAPWDTPANCELPL HPGWAFH
Source in vitro E.coli expression system
Gene Names OPN4
Protein Names Recommended name: Melanopsin Alternative name(s): Opsin-4
Expression Region 1-487
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for regulation of circadian rhythm. Contributes to pupillar reflex and other non-image forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Eye. Expression is restricted within the ganglion cell layer.
Database Links

KEGG: fca:493921

STRING: 9685.ENSFCAP00000013930

Related Products

OPN4 Proteins

OPN4 Proteins for Felis catus (Cat) (Felis silvestris catus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.