Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 2(LAMP2)

Code CSB-CF012740DXU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P49130
Storage Buffer Tris-based buffer,50% glycerol
Species Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Sequence FELNLPDSKATCLFAKWKMNFTISYETTTNKTLKTVTISEPHNVTYNGSSCGDDQGVAKIAVQFGSTVSWNVTFTKEESHYVIGSIWLVYNTSDNTTFPGAIPKGSATVISSQSIEIPLDDIFRCNSLLTFKTGNVVQNYWDIHLQAFVQNGTVSKEEFVCEEDKSVTTVRPIIHTTVPPPTTTPTPLPPKVGNYSVSNGNATCLLATMGLQLNVTEEKVPFIFNINPSTTNFTGSCHPQTAQLRLNNSQIKYLDFIFAVKSESHFYLKEVNVSMYMANGSVFSVANNNLSFWDAPLGSSYMCNKEQVVSVSRTFQINTFNLKVQPFNVTKGKYATAQDCSADEDNFLVPIAVGAALAGVLALVLLAYFIGLKRHHTGYEQF
Source in vitro E.coli expression system
Gene Names LAMP2
Protein Names Recommended name: Lysosome-associated membrane glycoprotein 2 Short name= LAMP-2 Short name= Lysosome-associated membrane protein 2 Alternative name(s): CD107 antigen-like family member B Lysosomal membrane glycoprotein B Short name= LGP-B
Expression Region 29-410
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live. Functions by binding target proteins, such as GAPDH and MLLT11, and targeting them for lysosomal degradation (By similarity). Plays a role in lysosomal protein degradation in response to starvation (By similarity). Required for the fusion of autophagosomes with lysosomes during autophagy. Cells that lack LAMP2 express normal levels of VAMP8, but fail to accumulate STX17 on autophagosomes, which is the most likely explanation for the lack of fusion between autophagosomes and lysosomes. Required for normal degradation of the contents of autophagosomes. Required for efficient MHCII-mediated presentation of exogenous antigens via its function in lysosomal protein degradation; antigenic peptides generated by proteases in the endosomal/lysosomal compartment are captured by nascent MHCII subunits. Is not required for efficient MHCII-mediated presentation of endogenous antigens (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, autophagosome membrane
Protein Families LAMP family
Database Links

KEGG: cge:100689316

Pathway Autophagy

Related Products

LAMP2 Proteins

LAMP2 Proteins for Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.