Recombinant Danio rerio Abhydrolase domain-containing protein 13(abhd13)

Code CSB-CF656280DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q32LS6
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MEKPWRLWGPLEACLLSVCAWSWGFCRVSLLALILTFHLYGGFVLLGLILASLAGILYKF QDVLLYFPDQPSSSRLYVPMPTGIPHENVYIRTKDGIRLNLILLRYTGENPAGAPTILYF HGNAGNIGHRVPNALLMLVNLKANVVLVDYRGYGKSEGDPSEDGLYQDAEATLDYVMTRP DIDKTKVVLFGRSLGGAVAIRLASCNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPL WCYKNKFLSYRHVVPCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHND TWQCQGYFSALEQFMKELLKSHAREETTQGTASVTII
Source in vitro E.coli expression system
Gene Names abhd13
Protein Names Recommended name: Abhydrolase domain-containing protein 13 EC= 3.-.-.-
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Serine esterase family
Database Links

KEGG: dre:561333

STRING: 7955.ENSDARP00000076697

UniGene: Dr.88157

Related Products

abhd13 Antibodies

abhd13 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

abhd13 Proteins

abhd13 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.