Recombinant Danio rerio Probable G-protein coupled receptor 173(gpr173)

Code CSB-CF872773DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9I918
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MANGNASSDGPGNPLAAVVSTTGGVMGGAPSSAVSTYVKLVLLGLIICISLVGNLVVSLL VLRDRALHKAPYYFLLDLCLADTIRSAVCFPFVLVSIKNGSAWTYSVLSCKVVAFMAVLF CFHAAFMLFCISVTRYMAIAHHRFYSKRMTFWTCVAVVCMVWTLSVAMAFPPVFDVGTYK FIREEDQCIFEHRYFKANDTLGFMLMLAVLILATHVVYMKLLLFEYKHRKMKPVQMVPAI SQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNLHNQNRRLLGMEEFKAEKQLGR MFYVITLFFLVLWSPYIVACYWRVFVKACTIPHRYLSTTVWMSFAQAGVNPIICFFLNKD LKKGLLAHLPPCCRTPPQLPREPYCVM
Source in vitro E.coli expression system
Gene Names gpr173
Protein Names Recommended name: Probable G-protein coupled receptor 173 Alternative name(s): Super conserved receptor expressed in brain 3
Expression Region 1-387
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: dre:57926

STRING: 7955.ENSDARP00000063004

UniGene: Dr.85372

Related Products

gpr173 Antibodies

gpr173 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

gpr173 Proteins

gpr173 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.