Recombinant Dog Gonadotropin-releasing hormone receptor(GNRHR)

Code CSB-CF009637DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9MZI6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MASASPEQNQNHCSAVNNSNMLMQGNLPTLTLSGKIRVTVTFFLFLLSTIFNASFLLKLQ KWTQKKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLK LFSMYAPAFMMVVISLDRSLAITRPLAMKNNGKLGQSMIGLAWLLSGIFAGPQLYIFRMI HLADSSGQTEGFPQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLFITLICNAKIIFTLTRV LHQDPHELQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRVS DPVNHFFFLFALLNPCFDPLIYGYFSL
Source in vitro E.coli expression system
Gene Names GNRHR
Protein Names Recommended name: Gonadotropin-releasing hormone receptor Short name= GnRH receptor Short name= GnRH-R
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: cfa:403718

STRING: 9615.ENSCAFP00000004111

UniGene: Cfa.3584

Related Products

GNRHR Proteins

GNRHR Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.