Recombinant Dog Rhodopsin(RHO)

Code CSB-CF019681DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P32308
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNVEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLAGWSRYIP EGMQCSCGIDYYTLKPEINNESFVIYMFVVHFAIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSDFGPIFMTLPAFFAKSSSI YNPVIYIMMNKQFRNCMITTLCCGKNPLGDDEASASASKTETSQVAPA
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Involvement in disease Defects in RHO are a cause of autosomal dominant retinitis pigmentosa (ADRP). The phenotypic features shared by dog and man include a dramatically slowed time course of recovery of rod photoreceptor function after light exposure and a distinctive topographic pattern to the retinal degeneration. This disease was identified in the English mastiff breed.
Subcellular Location Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Database Links

KEGG: cfa:493763

STRING: 9615.ENSCAFP00000006912

UniGene: Cfa.7396

Related Products

RHO Proteins

RHO Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.