Recombinant Dog Vasopressin V2 receptor(AVPR2)

Code CSB-CF002470DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O77808
Storage Buffer Tris-based buffer,50% glycerol
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MLLASTTSAVPRTLSPPTPAGNGSRELLDTRDPLLVQAELALLSTVFVAVALSNGLVLGA LARRVRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATDRFRGPDALCRAVKYLQMV GMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLILSLPQLFIFAQR DVGNGSGVLDCWAHFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHSSLVPGPA ERAGGCRGGHRTGSPSEGARVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPQAP LEGAPFVLLMLLASLNSCTNPWIYAFFSSSVSSELRSLFCWARSRAPPSLGPQEESCATA SSFLAKDTSS
Source in vitro E.coli expression system
Gene Names AVPR2
Protein Names Recommended name: Vasopressin V2 receptor Short name= V2R Alternative name(s): AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor
Expression Region 1-370
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links

KEGG: cfa:403804

STRING: 9615.ENSCAFP00000028678

UniGene: Cfa.3666

Pathway Oxidative Phosphorylation
Phospholipase D signaling pathway

Related Products

AVPR2 Proteins

AVPR2 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.