Recombinant Drosophila melanogaster Octopamine receptor beta-1R(oa2)

Code CSB-CF893260DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9VCZ3
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MTLLQRLQAMSATTTRTILEGSISSFGGGTNEPLASKIPVLEESASHARYLKFIADGLID EGLGSAVGSGSSIAVSVEDVVAGQAQDIQASEGSTDDADGSSHLALVFVKCFIIGFIILA AILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNASVMISGKWMFGSVMC DMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSF LPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEAD RQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTLGIIMSAFL ICWLPFFLWYIVSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK SLFPYAFYFCRRGRGRDDDRDLEFGGPSRRGTNGAQRTGSGSAEMANCVNSTASSEIHMS VMRARQYAVNVTPTTDAQMQQLHPLYTN
Source in vitro E.coli expression system
Gene Names Octbeta1R
Protein Names Recommended name: Octopamine receptor beta-1R Short name= DmOA2 Short name= DmOct-beta-1R
Expression Region 1-508
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Autoreceptor for octopamine, which is a neurotransmitter, neurohormone, and neuromodulator in invertebrates
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity In the adult, expressed in the superior protocerebrum and the optic lobe medulla of the central nervous system, nurse cells of egg chambers in the ovary at oogenic stages 1-10, and spermatogonia and spermatocytes in the testis (PubMed:22303848). Expressed
Database Links

KEGG: dme:Dmel_CG6919

STRING: 7227.FBpp0304263

UniGene: Dm.16604

Related Products

Octbeta1R Antibodies

Octbeta1R Antibodies for Drosophila melanogaster (Fruit fly)

Octbeta1R Proteins

Octbeta1R Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.