Recombinant Drosophila melanogaster Putative gustatory receptor 10b(Gr10b)

Code CSB-CF894757DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9VYZ2
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MRVGKLCRLALRFWMGLILVLGFSSHYYNPTRRRLVYSRILQTYDWLLMVINLGAFYLYY RYAMTYFLEGMFRRQGFVNQVSTCNVFQQLLMAVTGTWLHFLFERHVCQTYNELSRILKH DLKLKEHSRFYCLAFLAKVYNFFHNFNFALSAIMHWGLRPFNVWDLLANLYFVYNSLARD AILVAYVLLLLNLSEALRLNGQQEHDTYSDLMKQLRRRERLLRIGRRVHRMFAWLVAIAL IYLVFFNTATIYLGYTMFIQKHDALGLRGRGLKMLLTVVSFLVILWDVVLLQVICEKLLA EENKICDCPEDVASSRTTYRQWEMSALRRAITRSSPENNVLGMFRMDMRCAFALISCSLS YGIIIIQIGYIPG
Source in vitro E.coli expression system
Gene Names Gr10b
Protein Names Recommended name: Putative gustatory receptor 10b
Expression Region 1-373
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable gustatory receptor which mediates acceptance or avoidance behavior, depending on its substrates.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr10a subfamily
Database Links

KEGG: dme:Dmel_CG12622

STRING: 7227.FBpp0073395

UniGene: Dm.26608

Related Products

Gr10b Antibodies

Gr10b Antibodies for Drosophila melanogaster (Fruit fly)

Gr10b Proteins

Gr10b Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.