Recombinant Enterobacteria phage PRD1 Infectivity protein P11(XI)

Code CSB-CF326710EDO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27382
Storage Buffer Tris-based buffer,50% glycerol
Species Enterobacteria phage PRD1 (Bacteriophage PRD1)
Sequence MEKVKAWLIKYKWWIVAAIGGLAAFLLLKNRGGGSGGGGEYMVGSGPVYQQAGSGAVDNT MALAALQANTQLSAQNAQLQAQMDASRLQLETQLNIETLAADNAHYSTQSQLQLGMAQVD LSKYLGDLQSTTSTALAGMQSDTAKYQSNIQLQAENIRANTSLAEIDAQKYIVGKQADIA KYQAKTERRGQDYGFALGLLNFGGKFF
Source in vitro E.coli expression system
Gene Names XI
Protein Names Recommended name: Infectivity protein P11
Expression Region 1-207
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the phage ejection machinery. Pilot protein for the formation of the tube that conducts the genome into the target cell. Probably involved in penetration of the bacterial outer membrane and for making the peptidoglycan layer accessible to the viral transglycosylase. Essential for viral infectivity.
Subcellular Location Virion membrane, Single-pass membrane protein
Database Links

KEGG: vg:1260930

Related Products

XI Antibodies

XI Antibodies for Enterobacteria phage PRD1 (Bacteriophage PRD1)

XI Proteins

XI Proteins for Enterobacteria phage PRD1 (Bacteriophage PRD1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.