Recombinant Eulemur fulvus fulvus Melanocyte-stimulating hormone receptor(MC1R)

Code CSB-CF769673EPE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q864F6
Storage Buffer Tris-based buffer,50% glycerol
Species Eulemur fulvus fulvus (Brown lemur)
Sequence MPAQGSQRGLLGAVNFTPTATPHLRPAANQTGPQCLEVSVPDGLFLCLGLVSLVENTLVV AAIAKNRNLHSPMYCFICCLALSDLLVSVSNLLETAVLLLLEVGALAAQATVVQQLGNVI DVLICSSMVSSLCSLGAIAMDRYISIFYALRYHSIVTLARARRAIAAVWAASILSSTLFI TYYDRTAALLCLVVFFLAMLVLMALLYVHMLIQACQHAQAIARLHKRQHPVQQGWGLKGA ATLTILLGVFFLCWGPFFLHLTLIAVCPQHPTCSCIFKNFRLFLALIICNTIVDPLIYAF RSQELRRTLKEVLLFSW
Source in vitro E.coli expression system
Gene Names MC1R
Protein Names Recommended name: Melanocyte-stimulating hormone receptor Short name= MSH-R Alternative name(s): Melanocortin receptor 1 Short name= MC1-R
Expression Region 1-317
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Pathway Melanogenesis

Related Products

MC1R Proteins

MC1R Proteins for Eulemur fulvus fulvus (Brown lemur)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.