Recombinant Globicephala melas Rhodopsin(RHO)

Code CSB-CF019681GGI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O62792
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Globicephala melas (Long-finned pilot whale) (Globicephala melaena)
Sequence MNGTEGLNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSVLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYIPLNLAVANLFMVFGGFTTTLYTSLHAYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWVMAMACAAPPLVGWSRYIP EGMQCSCGIDYYTSRQEVNNESFVIYMFVVHFTIPLVIIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVVAFLICWVPYASVAFYIFTHQGSDFGPIFMTIPSFFAKSSSI YNPVIYIMMNKQLRNCMLTTLCCGRNPLGDDEASTTASKTETSQVAPA
Source in vitro E.coli expression system
Gene Names RHO
Protein Names Recommended name: Rhodopsin
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth (By similarity). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families G-protein coupled receptor 1 family, Opsin subfamily

Related Products

RHO Proteins

RHO Proteins for Globicephala melas (Long-finned pilot whale) (Globicephala melaena)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.