Recombinant Guinea pig Gonadotropin-releasing hormone receptor(GNRHR)

Code CSB-CF009637GU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8CH60
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Cavia porcellus (Guinea pig)
Sequence MQDDTSSEQNPTHCSAINSSVPLVQGALPTLTLSGKIRVTVTFFLFLVSTTLNASFLLKL QKWTQKKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKILSYL KLFSMYAPAFMMVVISLDRSMAITRPLPVQSNRKLEQSMTGLAWGLSSVLAGPQLYIFKM IHLENGPGQTEVFSQCVTHCSFPQWWHQAFYNFFTFICLFIIPLLIMLICNAKIIFTLTQ VLQQDSNKLQLNQSKNNIPRARLRTLKMTVAFAASFIVCWTPYYVLGLWYWFDPGMLHRM SEPVNHFFFLFAFLNPCFDPLIYGYFSL
Source in vitro E.coli expression system
Gene Names GNRHR
Protein Names Recommended name: Gonadotropin-releasing hormone receptor Short name= GnRH receptor Short name= GnRH-R
Expression Region 1-328
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 10141.ENSCPOP00000013163

Related Products

GNRHR Proteins

GNRHR Proteins for Cavia porcellus (Guinea pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.