Recombinant Guinea pig Mu-type opioid receptor(OPRM1)

Code CSB-CF016361GU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P97266
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Cavia porcellus (Guinea pig)
Sequence YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Source in vitro E.coli expression system
Gene Names OPRM1
Protein Names Recommended name: Mu-type opioid receptor Short name= M-OR-1 Short name= MOR-1
Expression Region 1-98
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell projection, axon, Perikaryon, Cell projection, dendrite, Endosome
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 10141.ENSCPOP00000017994

Pathway Estrogen signaling pathway

Related Products

OPRM1 Proteins

OPRM1 Proteins for Cavia porcellus (Guinea pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.