Recombinant Human 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2)

Code CSB-CF001450HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
AGPAT2; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-AGP acyltransferase 2; 1-AGPAT 2; Lysophosphatidic acid acyltransferase beta; LPAAT-beta
Species
Homo sapiens (Human)
Expression Region
24-278
Target Protein Sequence
AEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDP RRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINR QRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIVPVV YSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTP QENGATAGSGVQPAQ
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
Gene References into Functions
  1. The findings demonstrate that AGPAT2, which is mutated in patients with congenital generalized lipodystrophy and over-expressed in different types of cancer, is a direct transcriptional target of HIF-1, suggesting that upregulation of lipid storage by HIF-1 plays an important role in adaptation and survival of cancer cells under low oxygen conditions. PMID: 29908837
  2. Results show that LPAATbeta had high expression in osteosarcoma patients who received cisplatin treatment and cisplatin-resistant cancer cell lines. In vitro and in vivo studies provide evidence that LPAATB plays an important role in osteosarcoma. PMID: 28035350
  3. Data show that missense mutation c.299G>A changes serine in the acyltransferase NHX4D motif of AGPAT2, and intronic c.493-1G>C mutation destroy a splicing site that leads to exon 4 skipping and deletion of whole AGPAT2 substrate binding domain. PMID: 24498038
  4. the ability of LPAAT-beta to regulate mTOR function PMID: 24205284
  5. miR-24 may play an important role in inhibiting osteosarcoma growth through suppression of LPAATbeta. PMID: 23578572
  6. novel nonsense a missense mutations were found in two patients with congenital generalized lipodystrophy type 1. PMID: 22902344
  7. Data suggest that AGPAT2 regulates adipogenesis through modulation of lipid metabolism/signal transduction, altering normal activation of phosphatidylinositol 3-kinase (PI3K)/protooncogene c-Akt and PPARgamma signaling in early stage of adipogenesis. PMID: 22872237
  8. the role of AGPAT1 or AGPAT2 in liver lipogenesis is minimal and that accumulation of liver fat is primarily a consequence of insulin resistance PMID: 21873652
  9. lpaat beta gene overexpression exists in both AML and CML patients. lpaat beta produced by AML cells probably plays an important role in abnormal proliferation and drug-resistance of AML cells. PMID: 21176343
  10. Lysophosphatidic acid acyltransferase beta (LPAATbeta) promotes the tumor growth of human osteosarcoma PMID: 21152068
  11. AGPAT2 is mutated in congenital generalized lipodystrophy linked to chromosome 9q34. PMID: 11967537
  12. Congenital lipodystrophy patients with Seipin mutations have a more severe lack of body fat, which affects both metabolically active and mechanical adipose tissue, compared with patients with mutations in the AGPAT2 gene. PMID: 14602785
  13. mutations in AGPAT2 and Gng3lg are approximately equally represented in congenital generalized lipodystrophy PMID: 15181077
  14. reduction in AGPAT2 enzymatic activity underlies the loss of adipose tissue in congenital generalized lipodystrophy PMID: 15629135
  15. Our study shows that LPAAT-beta is upregulated in ovarian cancer and is more prevalent in poorly differentiated tumours PMID: 15841084
  16. mutations in AGPAT2 or Seipin may have roles in Berardinelli-Seip congenital lipodystrophy PMID: 16435205
  17. Berardinelli-Seip syndrome is a congenital form of generalized lipodystrophy, transmitted as an autosomal recessive trait. It is well documented in medicine and skin. It is a rare disorder caused by mutations of AGPAT2 gene or BSCL2 gene. PMID: 18155601
  18. A new subtype of congenital generalized lipodystrophy is not associated with the AGPAT2 gene. PMID: 18698612
  19. We have demonstrated four novel mutations of the BSCL2 and AGPAT2 genes responsible for Berardinelli-Seip syndrome and Brunzell syndrome (AGPAT2-related syndrome). PMID: 19226263
  20. Study showed that the cellular level of lysophosphatidic acid was increased in AGPAT2 deficient cells. PMID: 19278620

Show More

Hide All

Involvement in disease
Congenital generalized lipodystrophy 1 (CGL1)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Tissue Specificity
Expressed predominantly in adipose tissue, pancreas and liver.
Database Links

HGNC: 325

OMIM: 603100

KEGG: hsa:10555

STRING: 9606.ENSP00000360761

UniGene: Hs.320151

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1