Recombinant Human 5-hydroxytryptamine receptor 1A (HTR1A)

Code CSB-CF010881HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
HTR1A
Uniprot No.
Alternative Names
HTR1A; ADRB2RL1; ADRBRL1; 5-hydroxytryptamine receptor 1A; 5-HT-1A; 5-HT1A; G-21; Serotonin receptor 1A
Species
Homo sapiens (Human)
Expression Region
1-422
Target Protein Sequence
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli.
Gene References into Functions
  1. Study related 5-HT1A -cortical thickness correlation coefficients to the number of tracts connecting that region and the raphe, as measured by diffusion tensor imaging. The 5-HT1A -cortical thickness association correlated significantly with the number of tracts to each region. Defect in the raphe may affect the PCC within the default mode network in major depressive disorder through serotonergic fibers. PMID: 29323797
  2. The results suggest that HTR1A/1B DNA hypomethylation and its interaction with recent life stress might drive impaired antidepressant treatment response. Meanwhile, DNA methylation, in turn, was modified by antidepressant treatment and environments. PMID: 29275155
  3. Study found a significant interaction effect of the serotonin transporter-linked polymorphic region (5-HTTLPR) and the polymorphism in the serotonin 1A receptor gene (rs6295) on the connectivity within the right frontoparietal network, specifically in the middle frontal gyrus and inferior parietal lobule. Mean connectivity in the right inferior parietal lobule was positively correlated with working memory performance. PMID: 28793232
  4. results provide further supportive evidence of the effect of HTR1A and HTR5A on the etiology of schizophrenia and suggest that the selected genetic variations in HTR5A may be involved in impaired executive function. PMID: 27897266
  5. It is unlikely that the investigated genetic variants are clinically relevantly associated with depression after diagnosis of cancer. PMID: 28590587
  6. Studied association of aggression and 5-HTTLPR, 5HTR1A, and 5HTR2A genetic polymorphisms in industrial Russian and traditional Tanzanian population groups. PMID: 29661255
  7. Our results are in line with preclinical data, mouse model knockout studies as well as previous clinical analyses in major depressive disorder, demonstrating the two-pronged effect of the G allele on 5-HT1A receptor binding for, we believe, the first time. PMID: 28608854
  8. In summary, our results suggest that, by genetic association, the mu-opioid receptor interacts with serotonin transporter and serotonin 1A receptor to modulate exercise-induced hypoalgesia in fibromyalgia. PMID: 28282362
  9. Both expressions of CC2D1A and HTR1A genes studied on autism spectrum disorder cases and controls were significantly different PMID: 26782176
  10. Review/Meta-analysis: antipsychotic treatment may be more effective in improving negative symptoms in schizophrenic C allele than in G allele carriers of the HTR1A rs6295 polymorphism. PMID: 26568455
  11. The rs6295 single nucleotide polymorphism (SNP) in the 5HTR1A promoter region was associated with suicide attempt, psychiatric hospitalizations, and substance use disorder PMID: 28470485
  12. the rs6295 SNP, as a suspected variant that indicates susceptibility to schizophrenia, exhibited a higher transcriptional activity. PMID: 27939355
  13. This study demonstrated that a significant decrease in the protein level of 5-HT1A in major depression disorder. PMID: 27661418
  14. 5-HT1A rs10042486 was significantly associated with schizophrenia PMID: 27756686
  15. Results reveal the broad dependence that the 5-HT1A receptor has on plasma membrane properties, demonstrating that membrane lipid composition is a biochemical control parameter and highlighting the possibility that compositional changes related to aging, diet, or disease could impact cell signaling functions PMID: 27276266
  16. Sphingosine modulates the function of human serotonin1A receptors. PMID: 27984018
  17. The ganglioside GM1 interacts with the serotonin1A receptor via the sphingolipid binding domain. PMID: 27552916
  18. 5-HT1A C-1019G (rs6295) can predict aripiprazole treatment response specifically for cognitive and depressive symptoms in schizophrenia. PMID: 28027114
  19. results show that the oxidation of the hydroxyl group of cholesterol in live cells resulted in enhancement of agonist binding and G-protein coupling to the serotonin1A receptor with no appreciable change in overall membrane order; results extend our understanding of the structural requirements of cholesterol for receptor function PMID: 28109756
  20. rs6295 [C]-allele protects against depressive mood in elderly endurance athletes PMID: 26866771
  21. A single-nucleotide polymorphism of the serotonin 1a receptor gene (HTR1A) has been designated rs6295.28 and found to be overrepresented in suicide and associated with a decreased responsiveness to antidepressants. PMID: 26926882
  22. Results reported here strongly support the role of 5-HT1A partial agonism as a means of restoring cognitive function following subchronic treatment with an NMDAR non-competitiave antagonist PMID: 26342283
  23. This study demonistrated that cue learning, trait anxiety and genetic variability in 5-HTR1A are involved in the regulation of contextual anxiety. PMID: 25448266
  24. epistatic effects of 5HTR1A and 5HTR2A genes on suicidal behaviour were not significant PMID: 26544898
  25. Our findings provide supportive evidence that genetic polymorphisms in SLC6A4 and HTR1A may influence the risk of SZ in Han Chinese individuals PMID: 26408209
  26. IPO11-HTR1A is a significant risk gene region for attention deficit hyperactivity disorder in Caucasians. PMID: 26079129
  27. Also patients with a higher level of alexithymia and the HTR1A-G gene variant are more vulnerable to experiencing IFN-induced depressive symptoms PMID: 26609890
  28. No significant association was found between SNPs in HTR1A (rs6295), HTR2A (rs6311 and rs6313) and SLC6A4 and response to escitalopram in patients with major depressive disorder PMID: 26261165
  29. SNPs associated antipsychotic effectiveness in schizophrenia PMID: 25822479
  30. Increased serotonin function may result in further dysregulation of thalamocortical signals and so promote the expression of dyskinesias. PMID: 25649022
  31. The data on the distribution of allele and genotype frequencies of the HTR1A, HTR2A, and HTR1B genes can be used to determine the associations of the identified markers with various forms of human aggressive behavior. PMID: 26845861
  32. Studied site-directed mutants of the HTR1A receptor in application of yeast-based signaling sensor. PMID: 25850571
  33. mood disorders and HTR1A G allele variation, the C-1019G polymorphism of the transcriptional control region of the 5-HT1A receptor, independently predicted the incidence of IFN-induced depression in HCV patients. PMID: 26001668
  34. There was no impact of BDNF Val66Met genotype on serotonin transporter and serotonin-1A receptor BDNF binding. PMID: 25188405
  35. The C-1019G polymorphism of 5-HT1A was significantly associated with the odds of being single both before and after controlling for socioeconomic status, external appearance, religious beliefs, parenting style, and depressive symptoms. PMID: 25412229
  36. The findings support the hypothesis that COMT rs4680 and 5-HT1A-R rs6295 polymorphisms could influence the negative symptom response to clozapine, probably through modulation of the dopaminergic system. PMID: 25560469
  37. polymorphisms in the serotonin transporter gene are not associated with thermal pain sensation in healthy individuals PMID: 25472558
  38. The present results demonstrate that 5-HT signaling through the 5-HT1A receptor regulates some circadian properties PMID: 25446224
  39. Results suggest that the epileptic hippocampus of patients with mesial temporal lobe epilepsy presents an increase in 5-HT1A receptor-induced G-protein functional activation PMID: 25304920
  40. These findings provide the first evidence for the link between 5-HT1A and the development of alexithymic characteristics and attachment orientation. PMID: 25247748
  41. HTR1A variants play a central role in differentiating subgroups of patients with anxiety disorders. PMID: 25514753
  42. G/G genotype of HTR1A (rs6295) is associated with poor working memory in the premenstrual phase of PMDD-diagnosed women. PMID: 24158751
  43. Compared to GG and CG (1019) genotypes, men with CC genotype had a 250% and 190% shorter ejaculation time, respectively. PMID: 24440118
  44. 5-HT1A autoreceptors are recruited into a FGFR1-5-HT1A heteroreceptor complex in the midbrain raphe 5-HT nerve cells and may develop a novel function: a trophic role in midbrain 5-HT neuron systems originating from the dorsal and medianus raphe nuclei PMID: 25485703
  45. Epigenetic modification of transcriptional regulation by specific cytosine methylation may modulate HTR1A expression, resulting in effects on emotional dysfunction and negative symptom response to antipsychotic treatment. PMID: 24331356
  46. These data support a role for the 5-HT1A receptor in the aberrant decision-making that can occur in neuropsychiatric disorders such as depression PMID: 24429872
  47. In this review, 5-HT1A receptors are shown to interact with 5-HT7 receptors and have a role in depressive disorders. PMID: 24935787
  48. This study demonistrated that overexpression of platelet 5-HT1A receptors and reduced 5-HT tone may function as a peripheral marker of depression. PMID: 24657886
  49. IFN-alpha-related depression is associated with the CC genotype of the 5-HTR1A gene in hepatitis C patients. PMID: 24462335
  50. study found that rs6295 had no significant effect on the course of illness or treatment response in bipolar I disorder PMID: 24460115

Show More

Hide All

Involvement in disease
Periodic fever, menstrual cycle-dependent (PFMC)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite.
Protein Families
G-protein coupled receptor 1 family, 5-hydroxytryptamine receptor subfamily, HTR1A sub-subfamily
Tissue Specificity
Detected in lymph nodes, thymus and spleen. Detected in activated T-cells, but not in resting T-cells.
Database Links

HGNC: 5286

OMIM: 109760

KEGG: hsa:3350

STRING: 9606.ENSP00000316244

UniGene: Hs.247940

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X