Recombinant Human 5-hydroxytryptamine receptor 3A (HTR3A)

Code CSB-CF010890HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
HTR3A; 5HT3R; HTR3; 5-hydroxytryptamine receptor 3A; 5-HT3-A; 5-HT3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R; Serotonin receptor 3A; Serotonin-gated ion channel receptor
Species
Homo sapiens (Human)
Expression Region
24-478
Target Protein Sequence
RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTY IWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIRHQG EVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVF MNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVG FYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAET IFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQSTSQRPPATSQATKTDDCSAMGN HCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQELSSIRQFLEKRDEIREVARDWL RVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Gene References into Functions
  1. This study demonstrated that the C and E subunits when assembled as simple or complex heteromeric 5-HT3 receptors may alter efficacies of serotonin and clinically used antagonists. PMID: 29793334
  2. Methylation status of the HTR3A gene in mothers is linked to maternal violence-related psychopathology, trauma-induced brain activation patterns, and child attachment disturbance during a sensitive period in the development of self-regulation. PMID: 27720744
  3. This study did not found HTR3A play a major role in predicting Antipsychotic-Induced Weight Gain. PMID: 28531893
  4. Methylation pattern changes in the 5-HTR3A gene were associated with suicidal behavior in borderline personality disorder, bipolar disorder, and attention deficit/hyperactivity disorder (ADHD). PMID: 28470485
  5. findings suggest that HTR3A mRNA expression levels were positively correlated with craving in Han Chinese alcohol-dependent patients. PMID: 27144979
  6. Study provides structural data showing the orientation of palonosetron in a 5-HT3 receptor binding site mimic, combined with functional data in the 5-HT3 receptor, provide an explanation for the high affinity and long-lived actions of this compound. These are likely due to specific interactions formed with binding site residues, and its location as a tight and effective wedge in the binding pocket. PMID: 27656911
  7. Studies have demonstrated that 5-HT3 receptors modulate the activity of vascular and non-vascular smooth muscles. PMID: 27720614
  8. The HTR3A rs1062613 polymorphisms do not seem to directly influence experimental muscle pain in healthy individuals. However, women reported higher pain intensity and larger pain area than men, which might partly be attributed to genotype. PMID: 28002447
  9. Studies with 16 arylguanidines found that their functional activity spanned a broad spectrum from superagonist to full agonist, partial agonist, and antagonist at 5-HT3 receptors; results confirm the utility of phenylguanidine as an extremely versatile scaffold in the design of 5-HT3 ligands with a "tunable" level of agonist or antagonist activity PMID: 27533595
  10. Analysis of our small Chinese sample revealed a significant association of HTR3A with bipolar disorder, but yielded no evidence of an association between HTR3B and bipolar disorder. Furthermore, evidence for an association was found for a haplotype of HTR3A. PMID: 27706728
  11. Serotonin 3A receptor (5-HT3AR) is associated at the genetic and epigenetic levels with a variety of psychiatric disorders. PMID: 26350166
  12. A gene-environment interaction is revealed between childhood trauma and 5-htr3a polymorphisms. PMID: 26701104
  13. 5-HT3A receptor distal targeting in axons and dendrites depends on P2X2R expression. PMID: 26843630
  14. Agonist- and antagonist-induced up-regulation of surface 5-HT3 A receptors PMID: 25989383
  15. Data indicate that no two n-alkanols act alike, their spectra of effects on serotonin receptor 3A (5-HT3A) receptors differ. PMID: 25863270
  16. Our findings support the notion that different haplotypes of HTR3A have reciprocal effects in the etiology of Postoperative nausea. PMID: 25339231
  17. HTR3A gene variants may contribute to variability in severity of and response to antiemetic therapy for nausea and vomiting of pregnancy. PMID: 23786674
  18. These data support a role for intracellular salt bridges in maintaining the quaternary structure of the 5-HT3 receptor and suggest a role for the intracellular domain in allosteric modulation of cooperativity and agonist efficacy. PMID: 24283776
  19. To conclude, considering 5-hydroxytryptamine 3A subtype receptor role in accomplishment of asthma symptoms, this increase in its expression may exacerbate the seriousness of asthma disease. PMID: 24338226
  20. Data suggest that HTR3A/HTR3B subunits readily form functionally distinct heteromeric receptors; molecular models have been developed regarding affinities of competitive ligands, non-competitive antagonists, and allosteric modulators. [REVIEW] PMID: 23489111
  21. A significant increase in the relative expression level of 5-HT(3A) receptor in PBMCs. PMID: 24304330
  22. variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to etiology of alcohol, cocaine, and nicotine dependence PMID: 24590108
  23. the stoichiometry of 5-HT3AB receptors on the plasma membrane PMID: 23972841
  24. HTR3A, HTR3B, and SLC6A4 have significant interactions among their genes and are highly involved in nicotine dependence. PMID: 23290502
  25. Mutagenic analysis of the intracellular portals of the human 5-HT3A receptor. PMID: 24030822
  26. Genetic variability within SLC6A4, HTR3A, and HTR3B contributes to the risk of alcohol dependence and related phenotypes. PMID: 23757001
  27. Data indicate that Arg-436 is critical for the inward rectification of 5-HT3A receptor-mediated macroscopic currents. PMID: 23740249
  28. Polymorphisms in the HTR3A gene are predictors of reduced alcohol drinking in response to ondansetron. PMID: 23897038
  29. The findings of the present study do not support the involvement of the 5-HTR3A gene C178T polymorphism in tardive dyskinesia in Korean schizophrenia subjects. PMID: 23126479
  30. The association between HTR3A gene SNP and response to clozapine is influenced by various clinical predictors and by differing outcome definitions in patients with treatment-resistant schizophrenia. PMID: 22700043
  31. HTR3A and HTR3B were detected in all investigated brain tissues with the exception of the cerebellum, and large differences in the A:B subunit ratio were observed. PMID: 22832903
  32. Thus, rather than involving the 5-HT3-dependent pathway, the negative effect of ondansetron on platelet aggregation is instead manifested through the attenuation of agonist-induced IP3 production and MAPK (p38 and ERK2). PMID: 22818390
  33. This study does not support the hypothesis that the 5-HT(3A) receptor plays a major role in the pathogenesis of schizophrenia. PMID: 22328445
  34. CC genotype of TPH2 rs2171363, GG genotype of TPH2 rs7305115, CC genotype of HTR2A rs2770304, and CC genotype of HTR2A rs6313 were associated with reduced internalizing scores for children born in the quartile above the birth weightmidpoint. PMID: 21969281
  35. The serotonin receptor 3A c.-42T allele is associated with severe dyspeptic symptoms. The stronger association among dyspeptic patients carrying the serotonin transporter L allele suggests an additive effect of the two polymorphisms. PMID: 22014438
  36. Data show that 5-HTA/bungarotoxin binding sequence (BBS) receptors are constitutively internalized in the absence of an agonist and internalization as well as receptor function are inhibited by fluorescence. PMID: 21338684
  37. Report significant correlations of the HTR3A polymorphisms with amygdala responsiveness, anxiety, and irritable bowel syndrome symptom severity. PMID: 21420406
  38. Rings of charge within the extracellular vestibule influence ion permeation of the 5-HT3A receptor. PMID: 21454663
  39. findings indicate that HTR3A and HTR3B polymorphisms may not play a major role in the susceptibility to suicidal behavior in schizophrenia subjects. PMID: 21184810
  40. These findings suggest that the HTR3A CC genotype may be associated with alterations in brain structures central to emotion processing, particularly when exposed to stress. PMID: 20694966
  41. Six functional and coding variants of the subunit genes HTR3A, HTR3B as well as the novel HTR3C, HTR3D, and HTR3E subunits in the response to haloperidol or risperidone, were assessed. PMID: 19794330
  42. RIC-3 exclusively enhances the surface expression of human homomeric 5-hydroxytryptamine type 3A (5-HT3A) receptors despite direct interactions with 5-HT3A, -C, -D, and -E subunits. PMID: 20522555
  43. Evaluate HTR3A expression in normal and neoplastic B cells. PMID: 20516728
  44. variants in the HTR3A receptor gene can play a role in the treatment outcome of clozapine in schizophrenia patients that are refractory or intolerant of typical antipsychotic therapy PMID: 20168265
  45. 5-HT(3)A residue 312 and equivalent polar residues in the M3 of other Cys-loop subunits are essential determinants of homopentameric gating. PMID: 19933756
  46. the present investigation on transfected HEK293 cells revealed that Arg344His mutation of the h5-HT3A receptor, although not involved in genetic predisposition to schizophrenia, leads to a decreased density of the variant compared to wild type receptor PMID: 19904001
  47. These data provide direct evidence for an extracellular N-terminal domain and an intracellular loop between the third and fourth transmembrane domains, thus supporting the conventional ligand-gated ion channel subunit topological model. PMID: 12059035
  48. species-dependent gating mechanisms of 5-HT(3) receptors PMID: 12457738
  49. Cell surface expression of 5-hydroxytryptamine type 3 receptors is controlled by an endoplasmic reticulum retention signal PMID: 12750374
  50. 5HT3A receptor function and trafficking is regulated by protein kinase c through an F-actin-dependent mechanism PMID: 12791692

Show More

Hide All

Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily, HTR3A sub-subfamily
Tissue Specificity
Expressed in cerebral cortex, amygdala, hippocampus, and testis. Detected in monocytes of the spleen and tonsil, in small and large intestine, uterus, prostate, ovary and placenta.
Database Links

HGNC: 5297

OMIM: 182139

KEGG: hsa:3359

UniGene: Hs.413899

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1