Recombinant Human Antigen-presenting glycoprotein CD1d (CD1D)

Code CSB-CF004892HU(A4)
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CD1D
Uniprot No.
Alternative Names
Antigen-presenting glycoprotein CD1d; CD1.1; CD1A; CD1d; CD1D antigen; CD1D antigen d polypeptide; CD1d molecule; CD1D_HUMAN; Cd1d1 ; differentiation antigen CD1 alpha 3 ; HMC class I antigen like glycoprotein CD1D ; Ly 38; MGC34622; R3; R3G1; T cell surface glycoprotein CD1d ; Thymocyte antigen CD1D
Species
Homo sapiens (Human)
Expression Region
20-335
Target Protein Sequence
EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Gene References into Functions
  1. We have studied the relation of CD1d expression in various breast cancer cell lines to their viability and progression. We observed a novel phenomenon that CD1d expression level increases with the progressive stage of the cancer. PMID: 28633979
  2. CD1D has a role in disease progression and survival of chronic lymphocytic leukemia and may interact with CD161 PMID: 27385215
  3. CD1d-expressing cells isolated from peripheral blood of allogeneic hematopoietic stem cell transplantation patients showed the suppressive activity of T cell proliferation and higher expression of MyD88 and IDO compared with CD1d(-) cells. PMID: 29108995
  4. These findings suggest that VP22 is required (but not sufficient) for the inhibition of CD1d-mediated antigen presentation in herpes simplex virus type 1 infection. PMID: 27327902
  5. FasL expression in splenic CD5(+)CD1d(hi) B cells was decreased compared to the control group after TLR4 ligation. PMID: 28505514
  6. The expression of CD1d showed a significantly negative correlation with CD86 level in B cells from imiquimod (IMQ)-treated mice, B6.MRLlpr mice, and lupus erythematosus (SLE) patients. PMID: 28338767
  7. CD1d-restricted peripheral T cell lymphoma in mice and humans PMID: 27069116
  8. BCR-ABL-dependent ROCK, but not TK, is involved in CD1d downregulation. We propose that ROCK, which is most likely activated by the DH/PH domain of BCR-ABL, mediates iNKT-cell immune subversion in chronic myeloid leukaemia (CML) patients by downregulating CD1d expression on CML mDCs. PMID: 27513300
  9. Importantly, among the analyzed molecules, only CD1d expression showed an association with the activation of double-negative T cells, as well as with worse ventricular function in patients with Chagas disease. PMID: 27368347
  10. Data suggest that CD1d antigen-restricted B lymphocytes (Bc) presentation of NGcGM3 drives effective invariant natural killer T cells (iNKT) activation. PMID: 26969612
  11. the spatiotemporal distribution of CD1d molecules on the surface of antigen-presenting cells (APCs) modulates activation of Invariant natural killer T cells. PMID: 26798067
  12. both membrane-bound (V4) and soluble (V5) isoforms of CD1d were over-expressed in gastric tumor tissues, suggesting that they are involved in anti-tumor immune responses. PMID: 26119195
  13. This suggests that CD1D is more polymorphic than previously assumed PMID: 26041373
  14. by controlling a fundamental step in CD1d-mediated lipid antigen presentation, STAT3 signalling promotes innate immune responses driven by CD1d PMID: 26260288
  15. CD1d acts as a cell surface receptor that recognizes and binds oxysterols and initializes a pathway connecting oxysterol binding to PPARgamma activation PMID: 25618030
  16. Using diffraction-based dotReadytrade mark immunoassays, the present study showed that staphylococcal enterotoxin B directly and specifically conjugated to CD1d. PMID: 25649790
  17. High CD1d expression is associated with medulloblastomas. PMID: 25115738
  18. our results demonstrate that both Ets1 and miR-155 can directly regulate the expression of CD1d on B-cells PMID: 25929465
  19. Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression. PMID: 25878107
  20. simplexide, apart from activating iNKT cells, induces the production of cytokines and chemokines from human monocytes by direct interaction with CD1d PMID: 25390653
  21. CD1d expression in renal cell carcinoma correlated with aggressive disease and poorer clinical outcomes. PMID: 25477528
  22. These findings highlight how components from alphabeta and gammadeltaTCR gene loci can recombine to confer antigenic specificity. PMID: 25452463
  23. Expression of CD1d on B cells is suggestive of the ability of these cells to present antigens to, and form cognate interactions with, invariant natural killer T-Cells. (Review) PMID: 25381357
  24. We suggest that unique set of interactions between CEACAM5, CD1d, and CD8 render CD1d more class I-like molecule, facilitating antigen presentation and activation of CD8(+)-suppressor regulatory T cells. PMID: 24104458
  25. Data indictate variable expression of CD1d on chronic lymphocytic leukemia (CLL)lymphocytes and an association between high expression of CD1d with shorter time to treatment and overall survival of patients. PMID: 23668820
  26. results showed the interaction between endoplasmic reticulum (ER)- lumenal domain of HCMV US2 and alpha3 domain of hCD1d was observed within ER; these results show the function of HCMV US2 in immune evasive mechanisms against anti-viral immunity of invariant NKT cells PMID: 24213674
  27. CXCL16, iNKT cell-associated cell marker Valpha24, and CD1d were significantly upregulated in esophageal biopsies from EoE patients and correlated with the expression of inflammatory mediators associated with allergy. PMID: 24513807
  28. Relationship between high CD1d expression and shorter time to treatment and overall survival in chronic lymphocytic leukemia. CD1d expression in individual patients significantly changed over time. PMID: 24418751
  29. MHC class I physically associates with CD1d and regulates its functional expression on the cell surface. PMID: 24009709
  30. these results provide new insight into the control of CD1d gene expression, and they have implications for the evolution of CD1d and type I NKT cells. PMID: 24307737
  31. CD1d was found selectively expressed on the surface of hepatocytes in chronic hepatitis C, but not those subjects with history of alcohol usage or resolved chronic hepatitis C. PMID: 23808994
  32. The gamma-delta TCR docked orthogonally, over the A' pocket of CD1d, in which the Vdelta1-chain, and the germ line-encoded CDR1d loop, dominated interactions with CD1d. PMID: 24076636
  33. our findings strongly suggest that T322 and S323 form a dual residue motif that can regulate the functional expression of CD1d during a viral infection. PMID: 23710894
  34. Total CD1d levels are upregulated in pollen lipid-treated dendritic cells, which are then able to activate invariant natural killer (NK)T cells through a CD1d-dependent pathway. PMID: 23265858
  35. Type II NKT cells are absolutely dependent on CD1d expression in the thymus for their selection. CD1d trafficks between the cell surface & endosomes. It plays a role in presentating lipid antigens & mycobacterial antigens. Review. PMID: 23468111
  36. A novel, autoreactive, CD1d-restricted, GPI-specific T-cell population, enriched in an invariant TCRalpha chain, is expanded in paroxysmal noctural hemoglobinuria and may be responsible for bone marrow failure. PMID: 23372165
  37. Antigen presentation of keratinocyte to invariant killer cells show that these cells do not activate the cytotoxicity effector genes in resting iNKT-cells, but had the capacity to serve as targets for activated iNKT-cells dependent on CD1d expression. PMID: 23171451
  38. CD1d protein structure determines species-selective antigenicity of isoglobotrihexosylceramide (iGb3) to invariant NKT cells. PMID: 23280365
  39. A correlation between CD1d expression (a negative prognostic marker) and the soluble CTLA-4 in B-ALL patients was observed. PMID: 23049754
  40. crystallographic and biophysical analyses of alpha-galactosylceramide (alpha-GalCer) recognition by a human CD1d-restricted TCR PMID: 23109910
  41. Recombinant Vdelta1 TCRs from different individuals were shown to bind recombinant CD1d-sulfatide complexes in a sulfatide-specific manner. PMID: 22829134
  42. Human and mouse type I natural killer T cell antigen receptors exhibit different fine specificities for CD1d-antigen complex PMID: 22995911
  43. The binding of Sp1 to CD1d promoter and histone H3 acetylation on Sp1 sites were increased by histone deacetylase inhibitors. PMID: 22419072
  44. These findings provide insight into how lysophospholipids are presented by human CD1d molecules and how this complex is recognized by some, but not all, human Invariant Natural Killer T cells. PMID: 22395072
  45. Enhancing immunostimulatory function of human embryonic stem cell-derived dendritic cells by CD1d overexpression. PMID: 22407918
  46. Defective B cell-mediated stimulation of iNKT cells in SLE patients was associated with altered CD1d recycling. PMID: 22406267
  47. The serine-containing variant showed the strongest CD1d binding, offering an explanation for its predominance in vivo. PMID: 21956730
  48. CD1d appears to modulate some metabolic functions through an iNKT-independent mechanism PMID: 21980475
  49. phenyl glycolipids showed greater binding avidity and stability for iNKT T-cell receptor when complexed with CD1d PMID: 21987790
  50. These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity. PMID: 21853044

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Database Links

HGNC: 1637

OMIM: 188410

KEGG: hsa:912

STRING: 9606.ENSP00000357153

UniGene: Hs.1799

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1