Recombinant Human B1 bradykinin receptor (BDKRB1)

Code CSB-CF002651HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
BDKRB1
Uniprot No.
Alternative Names
BDKRB1; BRADYB1; B1 bradykinin receptor; B1R; BK-1 receptor
Species
Homo sapiens (Human)
Expression Region
1-353
Target Protein Sequence
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Gene References into Functions
  1. The findings revealed that serum B1R levels may provide prognostic information and currently act as potential indicators for progression in atherosclerosis. PMID: 28990089
  2. Data show that mRNA and protein of bradykinin type 2 receptors, but not bradykinin type 1 receptors, were abundant in cultured c-Kit+ progenitor cells. PMID: 28099911
  3. promotes adhesion of neutrophils to endothelial cells PMID: 24728914
  4. kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, resulting in significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist. PMID: 25289859
  5. BKR1 and BKR2 gene expression on peripheral monocytes is upregulated in essential hypertension PMID: 24401952
  6. B1 receptor-mediated vasodilatation in myometrial vessels absent in pre-eclampsia PMID: 24304135
  7. B1R agonist acts as a functional stimulus for the secretion of KLK1 and KLK6, an event relevant for kinin production and cell invasion, respectively PMID: 25503118
  8. Bradykinin B1 receptor signaling depends on receptor endocytosis. PMID: 23934212
  9. APJ and B1R can form heterodimers in transfected HEK293 cells and activations of APJ and B1R could up-regulate eNOS phosphorylation PMID: 24686079
  10. investigated if expression of B1 and B2 kinin receptors can be affected by IL-4 and IL-13; data show, for the first time, that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanism PMID: 23351078
  11. A novel B1R splice variant and promoter regulatory elements determine tissue-specific B1R expression. PMID: 24475248
  12. the relevance of kinin B1 and B2 receptors in bladder cancer, was investigated. PMID: 23224295
  13. CPM binding to extracellular loop 2 of the B1R results in positive allosteric modulation of B1R signaling, and disruption of this interaction could provide a novel therapeutic approach to reduce pathological B1R signaling. PMID: 24108126
  14. This review focuses on airway MAPK/NFkappaB-dependent kinin receptor upregulation that links the environmental risk factors to airway hyperreactivity and airway inflammation. PMID: 23428345
  15. Kinin B1 receptor homo-oligomerization is required for receptor trafficking to the cell surface PMID: 23201435
  16. Bradykinin B1 receptor is induced in inflammatory diseases and contributes to hyperthermia through a vagal sensory mechanism. PMID: 22971439
  17. A peptidase-resistant BR agonist had no significant direct or indirect acute effect (4h) on BR expression. PMID: 21986309
  18. The transcriptional activity of the B1 receptor for kinins increased in patients with grade 1 and grade 2 endometrial cancer when compared to the control group, whereas it decreased in patients with grade 3 endometrial cancer. PMID: 22706224
  19. bradykinin B1 is inhibited by chromomenones PMID: 22088753
  20. The up-regulation of HER2 and B(1)R in precursor lesions of gallbladder carcinoma suggests cross-talk between these two receptors that may be of importance in the modulation of cell proliferation in gallbladder carcinogenesis. PMID: 22468084
  21. Taken together, this study demonstrates that Pseudomonas aeruginosa is capable of up-regulating human B1R expression via the NF-kappaB signaling pathway. PMID: 22092568
  22. Comparing phospholipase C beta activity and Ca(2+)-regulated signals, a temperature-dependent increase was only observed for bradykinin B(1) but not for bradykinin(2)receptor activation. PMID: 21871009
  23. Remote ischemic preconditioning decreases expression of kinin receptors on circulating human neutrophils. PMID: 20189583
  24. CPM and B1Rs on cell membranes form a critical complex that potentiates B1R signaling. PMID: 21454694
  25. Data suggest that B1R inhibition can reduce BBB damage and cell invasion during autoimmune CNS disease and may offer a novel anti-inflammatory strategy for the treatment of MS. PMID: 21216565
  26. Release of metalloproteases-2 and -9 is blocked after silencing of the kinin B1 receptor with a siRNA. PMID: 21147512
  27. Severe inflammation characterizes rapidly progressive glomerulonephritides, and expression of the kinin B1 receptor (B1R) associates with inflammation. PMID: 20448019
  28. The up-regulation of B1 receptors may contribute to acute inflammatory pain through TRPV1 activation. PMID: 20152050
  29. human chondrosarcoma tissues had significantly higher expression of the B1 and B2 receptors comparing to normal cartilage PMID: 19885862
  30. Laminar shear stress is a major determinant of functional B1R expression in endothelium. PMID: 19661485
  31. B(1)R-epidermal growth factor receptor crosstalk may be a key interaction that maintains tumor growth PMID: 19184415
  32. both B1 receptor and gC1q receptor are involved in the vascular leakage induced by hereditary and acquired angioedema plasma. PMID: 19796797
  33. B1 and B2 receptor expression was enhanced in tumor cells and tissue adjacent to gastric cancer compared with gastric ulcers. PMID: 11710536
  34. Novel mode of action of angiotensin I converting enzyme inhibitors: direct activation of bradykinin B1 receptor PMID: 11880373
  35. Bradykinin B1 receptors are upregulated by inflammatory stimuli in bronchial epithelial cells. PMID: 12063092
  36. the C-terminal domain participates intimately in the efficacy of B1R and B2R G(q/11) coupling by contributing both positive and negative regulatory epitopes. PMID: 12130679
  37. Allergic rhinitis subjects displayed significantly higher expression of B1 receptor mRNA than did the normal subjects. PMID: 12165532
  38. B1R exists in caveolae-related lipid rafts (CLRs) in HEK293 cells apparently by default, as a result of their random distribution in the plasma membrane and not by being targeted to the CLR fraction. PMID: 12450400
  39. B1 and B2 bradykinin receptors form a complex with enhanced signaling capacity PMID: 15033977
  40. Bradykinin B(1) receptor homooligomerization is required for expression of receptors on the cell surface and subsequent constitutive receptor signaling. PMID: 15492119
  41. kinin B(1) receptors participate in painful and inflammatory disorders--REVIEW PMID: 15520046
  42. slow internalization of B(1)KB(2) was also accompanied by a lack of agonist-induced phosphorylation, that in contrast was observed for B(1)YB(2) and B(1)CB(2), suggesting that putative helix 8 is either directly or indirectly involved PMID: 15634338
  43. the two bradykinin receptors may play a role in blood pressure regulation PMID: 15643125
  44. The B1 kinin receptor does not have a major vasomotor or fibrinolytic role in patients with heart failure PMID: 15681300
  45. Use of the highly sensitive DNase I in vivo footprinting approach to delineate more precisely the functional domains of the BDKRB1 gene promoter in human smooth muscle cells is reported. PMID: 15705059
  46. bradykinin receptors in imflammatory bowel disease may reflect intestinal inflammation PMID: 15805101
  47. A novel class of 2,3-diaminopyridine bradykinin B1 receptor antagonists is disclosed using structure-activity relationship studies. PMID: 15837330
  48. BK-1Rs are induced in the endothelium of intramyocardial coronary vessels in failing human hearts and so may participate in the pathogenesis of heart failure. PMID: 15840906
  49. Kinin B1 receptor expression on multiple sclerosis mononuclear cells PMID: 15883268
  50. Increased level of bradykinin receptor B1 in adenoma suggests that kinins may play a role in abnormal cellular transformation. PMID: 16644486

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB1 sub-subfamily
Database Links

HGNC: 1029

OMIM: 600337

KEGG: hsa:623

STRING: 9606.ENSP00000216629

UniGene: Hs.525572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X