Recombinant Human Bcl-2-like protein 10 (BCL2L10)

Code CSB-CF884627HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
BCL2L10
Uniprot No.
Alternative Names
BCL2L10; BCLB; Bcl-2-like protein 10; Bcl2-L-10; Anti-apoptotic protein NrH; Apoptosis regulator Bcl-B
Species
Homo sapiens (Human)
Expression Region
1-194
Target Protein Sequence
MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGY PGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC LLTTAFIYLWTRLL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes cell survival by suppressing apoptosis induced by BAX but not BAK. Increases binding of AHCYL1/IRBIT to ITPR1. Reduces ITPR1-mediated calcium release from the endoplasmic reticulum cooperatively with AHCYL1/IRBIT under normal cellular conditions. Under apoptotic stress conditions, dissociates from ITPR1 and is displaced from mitochondria-associated endoplasmic reticulum membranes, leading to increased Ca(2+) transfer to mitochondria which promotes apoptosis.
Gene References into Functions
  1. marrow BCL2L10 positive cells may be a biomarker for azacitidine response and OS, with a potential impact in clinical practice. PMID: 28514758
  2. These results suggest that by inhibiting Bcl2l10 activity and promoting contact between endoplasmic reticulum and mitochondria, IRBIT facilitates massive Ca(2+) transfer to mitochondria and promotes apoptosis. PMID: 27995898
  3. we describe the identification of a structural genetic variant segregating with affective psychosis in a family with multiple members suffering from bipolar I disorder. Using whole-genome sequencing, we delineated the translocation breakpoints as corresponding intragenic events disrupting BCL2L10 and PNLDC1. These data warrant further consideration for BCL2L10 and PNLDC1 as novel candidates for affective psychosis. PMID: 27260655
  4. Results found that BCL2L10 was down-regulated in human hepatocellular carcinoma (HCC) tissues; its overexpression suppresses cell growth and migration of HCC cell lines. These results suggested that BCL2L10 functions as a tumor-suppressor in HCC. PMID: 27770580
  5. BCLB expression was a starvation stress sensor inducing apoptosis and autophagy simultaneously in HCC cells through the adenosine monophosphate-activated protein kinase AMPK-mTOR signaling cascade. PMID: 28259820
  6. Identification of a variant in the BCL2L10 gene as a protective factor for the development of therapy-related myeloid neoplasms and de novo myelodysplastic syndrome. PMID: 24047476
  7. polyubiquitination and proteasomal turnover dictate the expression level and anti-apoptotic capacity of Bcl-B PMID: 23563182
  8. Data suggest that BCL2L10 is localized predominantly to mitochondria in high-quality preimplantation embryos/blastocysts; in contrast, abnormal embryos/blastocysts exhibit extra-mitochondrial localization (cytoplasm/cell nucleus) of BCL2L10. PMID: 23293224
  9. Bcl-B in complex with the BH3 motif of Bim protected cells from Bax-dependent apoptotic pathways. PMID: 23235460
  10. Bcl-B interacts with the BH3 domain of BECN1 and Bcl-B overexpression reduces autophagy triggered by a variety of pro-autophagic stimuli. PMID: 22498477
  11. expression is predictive of azacitidine-resistance in myelodysplastic syndrome patients PMID: 22577154
  12. Ubqln stabilizes BCLb protein, while also promoting monoubiquitination on multiple lysine residues and relocation to the cytosol. PMID: 22233804
  13. BCL2L10 methylation is associated with myelodysplastic syndromes. PMID: 21760590
  14. Loss of BCL2L10 protein expression predicts poor clinical outcome in gastric carcinoma. PMID: 21166696
  15. The apoptotic gene BCL2L10 is a frequent target for aberrant promoter methylation in patients with acute leukemia, de novo and therapy-related. PMID: 21077739
  16. The pro-apoptotic effect of BCL2L10 and growth promotion by BCL2L10 siRNA in gastric cancer cells suggest that it may be a tumour suppressor. PMID: 21171085
  17. study evaluates 3D structure of Bcl-2L10 protein using homology modeling and aims to understand plausible functional and binding interactions between Bcl-2L10 with BH3 domain of BAX using protein - protein docking PMID: 20919753
  18. BCL2L10 is frequently silenced by promoter hypermethylation in gastric cancer. PMID: 20428828
  19. Thus, these results indicate the existence of a previously undiscovered mechanism by which NM23-H2 involves in the regulation of Diva-mediated apoptosis. PMID: 17532299
  20. distinctions in the behaviors of Bcl-B and Mcl-1 relative to the other anti-apoptotic Bcl-2 family members, where Bcl-B and Mcl-1 display reciprocal abilities to bind and neutralize Bax and Bak. PMID: 18178565
  21. Tumor-specific alterations in Bcl-B expression may define subsets of nonepithelial and epithelial neoplasms with distinct clinical behaviors. PMID: 18483366
  22. Interaction of endogenous proteins of BCL2L10 and HIP1R in 293T cells was determined by immunoprecipitation, and their direct association was confirmed by the Far-Western analysis. PMID: 19255499
  23. BCL2L10 Is a novel and prime candidate related to oocyte maturation, fertility, and embryo developmental competence PMID: 19551325

Show More

Hide All

Subcellular Location
Mitochondrion. Nucleus membrane. Endoplasmic reticulum.
Protein Families
Bcl-2 family
Tissue Specificity
Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney.
Database Links

HGNC: 993

OMIM: 606910

KEGG: hsa:10017

STRING: 9606.ENSP00000260442

UniGene: Hs.283672

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1