Recombinant Human C-C chemokine receptor type 3 (CCR3)

Code CSB-CF004842HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CCR3; CMKBR3; C-C chemokine receptor type 3; C C CKR3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR 3; CKR3; Eosinophil eotaxin receptor; CD antigen CD193
Species
Homo sapiens (Human)
Expression Region
1-355
Target Protein Sequence
MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for C-C type chemokine. Binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5) and CCL15. Subsequently transduces a signal by increasing the intracellular calcium ions level. In addition acts as a possible functional receptor for NARS1.; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
Gene References into Functions
  1. MACs from Familial hypercholesterolemia (FH)-MACs have an inflammatory phenotype that is characterized by the up-regulation of CCR3, CCR4, and CXCR1 under the control of miR-505-3p. These results suggest a chronic inflammatory condition in FH innate immunity cells that is not reverted by standard lipid-lowering treatment PMID: 29457550
  2. CCR3 exists as a mixture of monomers and dimers under nearly physiological conditions. The monomeric CCR3 receptor is the minimal functional unit in cellular signal transduction. Agonists increase dimers and oligomers at high concentrations. Antagonists do not affect oligomeric status. Monomeric CCR3 exhibits a stronger chemotactic response in the migration assay of stably transfected CCR3 cells. PMID: 28994588
  3. Study shows that CCR3, receptor of CCL28, was highly expressed in vascular endothelial cells in lung adenocarcinoma and is targeted by CCL28 to regulate angiogenesis. PMID: 27250766
  4. Findings suggest that CCL11-CCR3 binding is involved in the progression of GBM. PMID: 27119233
  5. Data show that high mRNA expression of CCR3 was related with improved relapse-free survival in luminal-A/B. PMID: 27086913
  6. the expression of CCR3 on dispersed synovial tissue and peripheral blood cells in rheumatoid arthritis, was investigated. PMID: 27495116
  7. Chemokine receptors CCR3 and CCR4, and the mucosa specific chemokine CCL28 have predominant roles in oral wound healing by increasing human gingiva fibroblast proliferation, migration, and the secretion of IL-6 and HGF and reducing the secretion of TIMP-1. PMID: 28387445
  8. simvastatin was demonstrated to inhibit IL-5-induced CCR3 expression and chemotaxis of eosinophils mediated via the mevalonate pathway. PMID: 27275740
  9. Data indicate that approximately 4.5% dispersed osteoarthritis (OA) synovial tissue cells are CC chemokine receptor CCR 3 (CCR3)+ cells. PMID: 26409848
  10. This meta-analysis provides robust estimates that interleukin 18 receptor accessory protein rs917997 and chemokine (C-C motif) receptor 3 rs6441961 are potential risk factors for celiac disease in European populations. PMID: 26289103
  11. Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion which stimulates CCR3 expressing tumor cells. PMID: 26756352
  12. Results show the structure of CCL11 bound to the sulfated N-terminal region of its receptor CCR3 and show that intact CCR3 is sulfated and sulfation enhances receptor activity. PMID: 25450766
  13. CCL28-CCR3 interactions are involved in the homeostatic trafficking of CD4(+) T cells to the upper airways. PMID: 24917456
  14. In vitro chemotaxis assay indicates dominant role of RANTES and IP-10 in the selective recruitment of CXCR3(+)CCR5(+)cells at the tubercular pathologic sites. PMID: 23643185
  15. CCR3-driven communication pathways from the epidermis to the dermis may modulate tissue remodeling in atopic skin inflammation. PMID: 23702389
  16. Retinoic acids up-regulate functional eosinophil-driving receptor CCR3. PMID: 23742077
  17. CCR3 demonstrates adequate sensitivity (83%) but weak specificity (59%) in its ability to reliably identify histamine-releasing activated basophils. PMID: 23955446
  18. Chemokine CCR3 ligands-binding peptides derived from a random phage-epitope library. PMID: 23183094
  19. Different GATA factors dictate CCR3 transcription in allergic inflammatory cells in a cell type-specific manner. PMID: 23636060
  20. rs3091250 single nucleotide polymorphism for CCR3 was found to be associated with age-related macular degeneration. PMID: 23566847
  21. CCR3 is strongly expressed by ASM cells in vitro and in vivo. Protection against cell death by CCR3 activation is dependent on p42/44 MAPK but does not affect caspase 3 mediated apoptosis. PMID: 22702503
  22. Methylation of CpG sites at the GATA elements in the regulatory regions fine-tunes CCR3 transcription. PMID: 22217447
  23. Cross-talk between CCR3 and VEGF signaling exists and may be important in choroidal neovascularization in human age-related macular degeneration. PMID: 21917937
  24. These results suggest that pulmonary epithelial CCR3 be involved in progression of lipopolysaccharide-induced lung inflammation by mediating release of IL-8. PMID: 21660963
  25. Data show that expression levels of CCL11 and CCR3 mRNA in the lesional skin of ALCL were significantly higher than those in normal skin. PMID: 21406396
  26. Leucocyte of children with infectious mononucleosis expressed higher level of CCR3 and lower level of CCR5. PMID: 21280323
  27. GATA-1 controls CCR3 transcription by interacting dynamically with multiple GATA sites in the regulatory region of the CCR3 gene. PMID: 21041734
  28. CCR3 expression in T-cells and the colon is increased in ulcerative colitis compared to inflammatory bowel disease and controls. PMID: 21077277
  29. CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease. PMID: 20659406
  30. CCR3 genetic polymorphisms may contribute to the development of the aspirin exacerbated respiratory disease phenotype and may be used as a genetic marker for differentiating between the two major aspirin hypersensitivity phenotypes. PMID: 20022477
  31. interaction of eotaxins and CCR3 regulates the Th2-dominant tumor environment, which is closely related to the development of cutaneous T-cell lymphoma PMID: 20505746
  32. The T17C chemokine receptor 3 polymorphism appears to be associated with asthma BHR and disease severity but not with atopy. PMID: 20726325
  33. The present data are of interest with regard to the potential use of AZD3778 in allergic rhinitis and to the relative importance of eosinophil actions to the symptomatology of allergic rhinitis. PMID: 20144207
  34. data support the role of DCs in differential regulation of CCR3 and CCR4 on CD4+ T cells from HDM-sensitive and non-atopic asthmatics after Der p 1 exposure. PMID: 20364559
  35. Data show that both plasma eotaxin level and expression of CCR3 on CD4+ T cells were higher in allergic patients than controls in different types of allergy. PMID: 20306659
  36. Alanine scanning mutagenesis of CCR3 reveals that the three intracellular loops are essential for functional receptor expression. PMID: 11920572
  37. bronchial expression up-regulated in exacerbations of chronic bronchitis PMID: 11991282
  38. demonstrated that CCR3 is absent from the testes PMID: 11994538
  39. downstream promoter element dependent, general transcription control mechanism is conserved between Drosophila and human genes PMID: 12079287
  40. CCR3 is expressed by dendritic cells (DCs) differentiated from blood monocytes, DCs that emigrate from skin (epidermal and dermal DCs), and DCs derived from CD34+ hemopoietic precursors in bone marrow, umbilical cord blood, and leukapheresis collection. PMID: 12218106
  41. results suggest that expression of chemokine receptor 3(CCR3) and its ligand eotaxin/CCL11 plays a role in the recruitment and retention of CD30(+) malignant T cells to the skin PMID: 12393570
  42. This protein mobilizes to the surface of human mast cells and potentiates immunoglobulin E-dependent generation of interleukin 13. PMID: 12654630
  43. Eosinophil CCR3 expression between atopic individuals does not correlate with atopy or serum IgE levels, nor is the status of macrophage-inflammatory protein-1alpha-highly responsive donors associated with increased chemattractant receptor expression. PMID: 12794150
  44. eosinophil responses mediated by chemokines acting at CCR3 may be regulated by two distinct mechanisms: the antagonistic effects of CXCR3 ligands and the sequestration of CCL11 by CXCR3-expressing cells PMID: 12884299
  45. Ligation of CCR3 by eotaxin/chemokine ligand (CCL) 11 induces apoptosis in IL-2- and IL-4-stimulated primary CD19+ B cell cultures (approximately 40% apoptotic cells) as well as B cell lines, but has no effect on chemotaxis or cell adhesion. PMID: 12902471
  46. Single nucleotide polymorphism is not associated with atopic dermatitis in Japanese. PMID: 14581140
  47. the two N-terminal motifs of eotaxin must cooperate with other regions to successfully bind and activate CCR3 PMID: 14733956
  48. examination of the role of epidermal growth factor receptor in CCR3 signaling PMID: 15219825
  49. multiple residues on multiple extracellular domains of hCCR3 are important for coreceptor activity for HIV-1. PMID: 15476879
  50. the restoration of CRTH2(chemoattractant receptor-homologous molecule expressed on Th2 cells)/CCR3 expression may be an indicator for optimal recovery after septic shock PMID: 15507393

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In eosinophils as well as trace amounts in neutrophils and monocytes.
Database Links

HGNC: 1604

OMIM: 601268

KEGG: hsa:1232

STRING: 9606.ENSP00000441600

UniGene: Hs.506190

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1