Recombinant Human CD151 antigen (CD151)

Code CSB-CF004880HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD151; TSPAN24; CD151 antigen; GP27; Membrane glycoprotein SFA-1; Platelet-endothelial tetraspan antigen 3; PETA-3; Tetraspanin-24; Tspan-24; CD antigen CD151
Species
Homo sapiens (Human)
Expression Region
1-253
Target Protein Sequence
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNT ELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVV PDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.; (Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor.
Gene References into Functions
  1. Results provide evidence that bi-allelic loss-of-function mutations in CD151 underlie an autosomal recessive mechano-bullous disease with systemic features suggesting that CD151 as the 20th causative, EB-associated gene. PMID: 29138120
  2. The expression levels of RNASEH2A, CDK1, and CD151 and their combination could predict the survival of renal cell carcinoma patients. PMID: 29843367
  3. We conclude that LAMC1 mRNA acts as a trans regulator to stimulate CD151 expression by competing for miR-124 binding in hepatocellular carcinoma cells. PMID: 28524360
  4. CD151 overexpression was associated with poor survival in human solid tumors. CD151 could be a valuable prognosis biomarker or a potential therapeutic target of solid tumors. PMID: 27888619
  5. Levels of CD151 Gene Expression are Independently Associated with Survival in Chemoradiotherapy-Naive Patients PMID: 27577713
  6. CD151 induces osteosarcoma metastasis likely by regulating cell function through adhesion signaling PMID: 27556355
  7. These results elucidated that PIK3C2A mRNA acts as a miR-124 decoy to regulate CD151 and to affect hepatocellular carcinoma malignant phenotypes. PMID: 27270320
  8. the tetraspanin CD151 contributes to survival of a subset of high-grade serous ovarian cancer cell lines. PMID: 28273451
  9. CD151 in humans thus marks and enables hyperproliferative T cells. PMID: 28954890
  10. Here, we demonstrate for the first time that the tetraspanin CD151 supports lymphocyte adhesion to liver endothelium. We show that CD151 is upregulated in chronic liver disease and hepatocellular carcinoma (HCC) and is regulated on endothelium by tissue remodeling and procarcinogenic factors. PMID: 28473332
  11. Our data uncover a previously unknown mechanism for modulating human airway smooth muscle contraction, implicating CD151 as a determinant of airway hyper-responsiveness in vivo, likely through regulation of G protein-coupled receptor-induced calcium mobilization and protein kinase c signaling PMID: 27233153
  12. Reciprocal fusion gene involving TSPAN4-CD151 is associated with infratentorial anaplastic ependymoma. PMID: 27401149
  13. High CD151 expression is associated with hepatocellular carcinoma. PMID: 27599545
  14. Eight and five of the nine samples were negative for cell adhesion molecule 1 and Osterix respectively. The other markers showed no statistical significance(CD151,ALP). osteoblastic differentiation can occur in carcinoma cells and that cell adhesion molecule 1 could be a useful marker for identifying this phenomenon in carcinoma tissues. PMID: 28651491
  15. High CD151 expression is associated with Human Cytomegalovirus Infection. PMID: 27147745
  16. Knockdown and knockout models revealed that CD151 and Tspan8 act as molecular facilitators in wound healing, angiogenesis and tumor progression. [review] PMID: 28408484
  17. CD151 participates in communication between PC3 prostate cancer cells and bone microenvironment and the process can be considered as a significant step of prostate cancer progression and metastasis. PMID: 28291843
  18. Platelet-enhanced endothelial colony forming cell angiogenesis requires platelet tetraspanin CD151 and alpha6beta1 integrin signaling. PMID: 26749288
  19. these findings identify CD151 and its interactions with integrins a3 and a6 as potential therapeutic targets for inhibiting stemness-driving mechanisms and stem cell populations in Glioblastoma. PMID: 26992919
  20. CD151 knockdown inhibits the expression of MMP9 through the GSK-3b/bcatenin pathway and also inhibits Osteosarcoma (OS)migration and invasion in vitro and metastasis in vivo in highly metastatic OS. PMID: 26707073
  21. the role of the CD151-alpha3beta1 complex in carcinoma progression is context dependent, and may depend on the mode of tumor cell invasion. PMID: 26418968
  22. selective interaction with PY12 oligomers is crucial for platelet aggregation and thrombus stabilization PMID: 26245294
  23. In high grade DCIS, when stratified according to the HER2 status, in the HER2-negative subgroup, CD151 assessed in combination with alpha3beta1 was significantly correlated with prognosis. PMID: 26464707
  24. Data show that CD151 protein (CD151)-alpha3beta1 integrin complexes cooperated with epidermal growth factor receptor (EGFR) to drive tumor cell motility. PMID: 26377974
  25. Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation. PMID: 26136426
  26. our study demonstrates that CD151-alpha3beta1 integrin complexes regulate ovarian tumor growth by repressing Slug-mediated epithelial to mesenchymal transition and Wnt signaling PMID: 25356755
  27. Knockdown CD151 expression by targeted siRNA could inhibit the related downstream intercellular signaling pathways including FAK, PI3KAKT, MEKERK1/2MAPK as well as the expression of MMP9 and VEGF. PMID: 25351816
  28. Increased expression of CD151 is associated with gastric cancer. PMID: 25119599
  29. might be a potential prognostic indicator for gallbladder carcinoma PMID: 24890568
  30. CD151 overexpression is associated with gastric cancer. PMID: 24306658
  31. Taken together, it was concluded that CD151 promotes the proliferation and migration of PC3 cells through the formation of CD151-integrin complex and the activation of phosphorylated ERK. PMID: 22684562
  32. CD151 expression is associated with lymphatic vessel density in prostate cancer. PMID: 24174171
  33. Data indicate that overexpression of CD151 significantly attenuated the tumor suppressive effect of miR-22. PMID: 24495805
  34. Review on CD151 in cancer progression and metastasis. PMID: 24247563
  35. CD151-AAA mutant was able to promote cell proliferation, while the ability of CD151AAA to promote cell proliferation was decreased compared with the CD151 group. PMID: 23007325
  36. High CD151 expression correlated with aggressive behavior in non-small cell lung cancer.High CD151 protein expression was an independent negative prognostic factor for overall survival in lung adenocarcinoma, but not in lung squamous cell carcinomas. PMID: 23570797
  37. The expression rate of CD151 seemed to increase gradually according to the depth of invasion and pathologic stage in gastric ademocarcinoma. PMID: 24005419
  38. Data indicate that alpha3beta1 and the tetraspanin CD151 directly associate at the front and retracting rear of polarised migrating breast carcinoma cells. PMID: 22986527
  39. High CD151 expression is associated with glioma. PMID: 22495828
  40. CD151 is positively associated with the invasiveness of HGC, and CD151 or the combination of CD151 and integrin alpha3 is a novel marker for predicting the prognosis of HGC patient. PMID: 23533596
  41. Overexpression of CD151 was observed in a significant proportion of glioblastomas. CD151 overexpression was closely associated with MGMT methylation and was a prognostic factor for predicting worse survival. PMID: 22926763
  42. High CD151 expression is associated with skin squamous cell carcinoma. PMID: 22824799
  43. These data show that complex formation of CD151 with laminin-binding integrins and integration of the complex into tetraspanin-enriched microdomains are critical for human papillomavirus type 16 endocytosis. PMID: 23302890
  44. clinical data analyses revealed a strong correlation between CD151 and ErbB2 expression and metastasis-free survival of breast cancer patients PMID: 22952421
  45. CD151 support of alpha6 random defined diffusion is specific and functionally relevant, and probably underlies diverse CD151 functions in skin, kidney and cancer cells. PMID: 22328509
  46. CD151 links alpha(3)beta(1)/alpha(6)beta(1) integrins to Ras, Rac1, and Cdc42 by promoting the formation of multimolecular complexes in the membrane, which leads to the up-regulation of adhesion-dependent small GTPase activation PMID: 22843693
  47. Secreted CD151 can be a useful genetic marker for the diagnosis of metastatic prostate cancer. PMID: 22457534
  48. CD151 importantly modulates podocyte function. PMID: 22338088
  49. CD151 overexpression in breast cancer was found to be significantly associated with larger tumour size, higher nodal stage, advanced stage, absence of oestrogen receptor and progesterone receptor and human epidermal growth factor receptor 2 overexpression PMID: 22294188
  50. Data show that CD151 acts as an important player in the progression of HCC in an integrin beta1-dependent manner. PMID: 21961047

Show More

Hide All

Involvement in disease
Nephropathy with pretibial epidermolysis bullosa and deafness (NPEBD)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes.
Database Links

HGNC: 1630

OMIM: 179620

KEGG: hsa:977

STRING: 9606.ENSP00000324101

UniGene: Hs.654379

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1