Recombinant Human Cholecystokinin receptor type A (CCKAR)

Code CSB-CF004772HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CCKAR; CCKRA; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Species
Homo sapiens (Human)
Expression Region
1-428
Target Protein Sequence
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH MSASVPPQ
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. CCK1R may play a role differing from CCK2R in colon carcinogenesis, nuclear CCK1R represents a potential biomarker for poor prognosis. PMID: 26508021
  2. Study shows downregulation of CCKAR gene expression in A1/A1 genotype of gallstone disease patients as compared with control with significant variation in its expression pattern in relation to polymorphism. PMID: 27287528
  3. Our study showed significantly higher expression of CCKAR and down regulation of CCKBR in pancreatic cancer as compared to control while CCKBR/GR was detected in majority of stomach cancer samples. Thus, our study suggests that CCK and Gs receptors may have diagnostic and therapeutic implications. PMID: 27072272
  4. The neurotransmitter cholecystokinin (CCK), along with its receptors, CCKAR and CCKBR, have been previously associated with psychiatric disorders, suggesting that variants near these genes may play a role in the pre-pulse/startle response in this cohort PMID: 26608796
  5. CCK-AR polymorphism is protective against functional dyspepsia. PMID: 26551933
  6. There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development. PMID: 25875176
  7. Age related differential expression of CCKAR in GBC may suggest two possible variants of the disease in this endemic belt. PMID: 25025063
  8. Y140A mutation within a cholesterol-binding motif results in ligand binding and activity characteristics similar to wild type CCK1R. in a high cholesterol environment PMID: 24825903
  9. The findings suggest that variants in the CCKAR gene may influence the risk of gallbladder cancer in women. PMID: 23701593
  10. A significant association of the cholecystokinin-A receptor (CCKAR) gene variation rs1800857 and language lateralization, is reported. PMID: 23341962
  11. The results showed that three individual haplotypes of CCKAR were strongly associated with increased risk of schizophrenia. PMID: 22825913
  12. Data suggest that CCK-1R expression is up-regulated in kidney tubules (but not in glomeruli) in patients with diabetic nephropathy; increased expression of CCK-1R in tubules appears to be biomarker of severity of proteinuria in these patients. PMID: 22396142
  13. data may suggest that the TM3 CRAC cholesterol-binding motif could be responsible for the cholesterol sensitivity of the CCK1R. PMID: 22021636
  14. CCKAR expression was significantly increased in gallbladder cancer compared to gallstone disease. PMID: 21813391
  15. Data indicate that the Homo-Phe derivative 2 (VL-0797) enhanced 12-fold the affinity for the rat CCK(1)-R affinity and 15-fold for the human CCK(1)-R relative to the reference compound 12 (VL-0395). PMID: 21728335
  16. An association is not found between cholecystokinin A receptor polymorphisms and antipsychotic induced weight gain in schizophrenia patients. PMID: 20732371
  17. LPS can up-regulate the expression of CCK-AR and CCK-BR mRNA in vascular endothelial cells. PMID: 19751565
  18. a 2-marker haplotype (rs1800855/rs1800857) in the CCKAR gene protected women against PD (P=0.004). In addition, we found two novel rare missense variations in the CCKBR gene (Lys329Asn and Pro446Leu) in two and one patient, respectively PMID: 20023595
  19. an intron 1 polymorphism in the cholecystokinin A receptor gene is associated with schizophrenia in males PMID: 19753663
  20. Significant association between polymorphism at the -85 locus of the CCKAR gene in patients with hallucination, especially patients with hallucination in delirium tremens. PMID: 12198366
  21. the presence of CCK receptors in human ductal pancreatic tumor samples is mainly due to CCK2 expression in residual pancreatic islets and CCK1 in pancreatic nerves. PMID: 12851875
  22. heterodimerization of type A and B cholecystokinin receptors forms a powerful signaling unit with potential clinical significance in promoting cell growth PMID: 14534299
  23. In this review, both localization and functional studies suggest that the motor effects of cholecystokinin are mediated by CCK1/CCKA receptors in humans. PMID: 15100163
  24. CCK-AR gene polymorphism may be involved in the neurobiology of panic disorder. PMID: 15108185
  25. CCK-AR gene is suggested to predispose persons to schizophrenia. PMID: 15363473
  26. analysis of partial and full agonism mediated by the human cholecystokinin-1 receptor PMID: 15632187
  27. Finds significant differences in intelligence for Cholecystokinin A receptor gene promoter polymorphisms A-81G and G-128T in community-living Japanese. PMID: 15723764
  28. the deficiency of CCK-R may be a key point leading to the impairment of gallbladder motor function and the pathogenesis of cholesterol gallstone formation PMID: 15786550
  29. possible role of the CCK-AR gene in the vulnerability to schizophrenia in patients with auditory hallucinations PMID: 17413443
  30. No evidence for the association between the CCK-AR gene and schizophrenia in the Japanese population. PMID: 17413452
  31. CCK-A receptor agonist, GI181771X, did not reduce body in obese patients, suggesting that CCK-A by itself does not have a central role in long-term energy balance. PMID: 17597711
  32. Responses of human esophageal sphincter sling and clasp fibers to cholecystokinin (CCK) and gastrin through CCK-A and -B receptors are reported. PMID: 18444993
  33. Report effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation. PMID: 18776046

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 1570

OMIM: 118444

KEGG: hsa:886

STRING: 9606.ENSP00000295589

UniGene: Hs.129

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×