Recombinant Human Claudin-11(CLDN11)

Code CSB-CF005492HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CLDN11
Uniprot No. O75508
Alternative Names CLDN11; OSP; OTM; Claudin-11; Oligodendrocyte-specific protein
Species Homo sapiens (Human)
Expression Region 1-207
Target Protein Sequence MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA QLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG DAQAFGENRFYYTAGSSSPTHAKSAHV
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. expression of claudin-11 in cutaneous squamous cell carcinoma (cSCC) cells depended on the activity of p38delta MAPK; knock-down of claudin-11 enhanced cSCC cell invasion PMID: 27992079
  2. Authors demonstrated that CLDN11 promoter hypermethylation is a frequent event in LSCC, and contributes to metastasis and progression of LSCC. PMID: 28743857
  3. The expression of claudin-11, -23 was remarkably downregulated in gastric cancer. PMID: 28350854
  4. Claudin-11 might represent the essential component of the blood-testis barrier in human. PMID: 27486954
  5. the expression of miR-99b was inversely correlated with CLDN11 levels . These findings suggest that a high level of miR-99b expression is an independent prognostic factor and correlates with poor survival of patients with Hepatocellular carcinoma (HCC) PMID: 26134929
  6. CLDN11 is an epigenetic biomarker for malignancy in dysplastic nevus and melanoma. PMID: 24999589
  7. these data suggest that cancer cells may induce CLDN11 overexpression and subsequent collective migration of peritumoral CAFs via TGF-beta secretion. PMID: 24268521
  8. The expression of claudin-11 was up regulated in gastric cancer tissue. PMID: 23919729
  9. The spatial organization of claudin-11 and connexin-43 is altered in men with primary seminiferous tubule failure. PMID: 23706332
  10. disorganization of claudin-11 expression in Sertoli cells might be one of the factors involved in the impairment of spermatogenesis. PMID: 22951003
  11. Treatment with 3-deazaneplanocin A, an inhibitor of H3K27 methyltransferase, attenuated CLDN11 induction by serum stimulation in parallel with sustained miR-1275 expression PMID: 22736761
  12. claudin-11 may have a role in preventing cancer progression and may serve as a therapeutic target in reducing metastasis PMID: 21468549
  13. late spermatogenic wave may negatively regulate claudin-11 gene activation and the subcellular localization of claudin-11 in Sertoli cells, thus altering the blood testis barrier in the human testis PMID: 20850723
  14. Claudins 11,expression in meningiomas. PMID: 20546350
  15. hypermethylation of CLDN11, leading to downregulated expression, contributes to gastric carcinogenesis by increasing cellular motility and invasiveness PMID: 19956721
  16. Contribution of the tight junction protein CLDN11 to barrier function in endothelial cells is novel and may reflect hemodynamic requirements of the corpus cavernosum. PMID: 19622796
  17. Data demonstrate that in rhesus monkeys immune responses directed at human OSP are encephalitogenic, leading to inflammatory responses throughout the central nervous system and to selective demyelination of the optic nerve. PMID: 18412169
  18. the disruption of the blood-testis barrier is related to a dysfunction of claudin-11 and not to a failure of its expression. PMID: 19241088

Show More

Hide All

Subcellular Location Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families Claudin family
Database Links

HGNC: 8514

OMIM: 601326

KEGG: hsa:5010

STRING: 9606.ENSP00000064724

UniGene: Hs.31595

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1