Recombinant Human Coiled-coil domain-containing protein 56(CCDC56)

Code CSB-CF896698HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9Y2R0
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence ASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTG LGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS
Source in vitro E.coli expression system
Gene Names COA3
Protein Names Recommended name: Coiled-coil domain-containing protein 56
Expression Region 2-106
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly.
Subcellular Location Mitochondrion inner membrane, Single-pass membrane protein
Protein Families COA3 family
Database Links

HGNC: 24990

OMIM: 614775

KEGG: hsa:28958

STRING: 9606.ENSP00000354762

UniGene: Hs.16059

Related Products

COA3 Antibodies

COA3 Antibodies for Homo sapiens (Human)

COA3 Antibodies for Human

COA3 Proteins

COA3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.