Recombinant Human D (4) dopamine receptor (DRD4)

Code CSB-CF007181HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
DRD4; D(4 dopamine receptor; D(2C dopamine receptor; Dopamine D4 receptor
Species
Homo sapiens (Human)
Expression Region
1-467
Target Protein Sequence
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that regulates emotion and complex behavior. Activated by dopamine, but also by epinephrine and norepinephrine, and by numerous synthetic agonists and drugs. Agonist binding triggers signaling via G proteins that inhibit adenylyl cyclase. Modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Gene References into Functions
  1. Mothers who carry the long allele of DRD4 and experienced more adverse life events are less sensitive in interactions with their children. PMID: 30035571
  2. The presence of the DRD4 7-repeat allele was associated with less disorganized attachment and the effect of the DRD4 genotype may be moderated by infant birth weight and by maternal depression. PMID: 29149620
  3. genetic association studies in population of young adults in Columbia: Data suggest that genetic polymorphisms in DRD4 and SLC6A3 are associated with overweight/obesity in the population studied; DRD4 4/4 genotype is associated with lower BMI and SLC6A3 10/10 genotype is associated with higher BMI. (DRD4 = dopamine receptor D4; SLC6A3 = solute carrier family 6 member 3) PMID: 29145734
  4. data imply that enhanced D4 receptor-mediated dopaminergic control of corticostriatal transmission constitutes a vulnerability factor of ADHD and other neuropsychiatric disorders. PMID: 28097219
  5. These data suggest that the DRD4 polymorphisms are associated with localized brain activity and specific functional connections, including abnormality in the frontal-striatal-cerebellar loop. PMID: 29564731
  6. These results showed that C-allele carriers were associated with a higher erousal from sleep, decreased gray matter volume and functional connectivity density in the pregenual anterior cingulate cortex; children with primary nocturnal enuresis carrying the C allele exhibit decreased gray matter volume and functional connectivity density in the thalamus. PMID: 28450726
  7. Results suggest that alterations in the glutamate and dopamine system (GRIN2B and DRD4) in attention-deficit/hyperactivity disorder may contribute to abnormalities in local functional connectivity and its dynamic repertoire in the superior parietal area, and these abnormalities would be related to dysfunction in sustained and divided attention. PMID: 28258362
  8. There is significant interaction effects of the GIT1 and DRD4 gene variants on impulsivity in Attention Deficit Hyperactivity Disorder. PMID: 28948080
  9. The DRD4 and 5HTR2A genes are co-expressed in Peripheral Blood Mononuclear Cells during antipsychotic administration. Despite a correlation between the studied biogenic amine indicators and the psychopathological status of patients, reliable biomarkers of treatment response could not be determined. PMID: 29221470
  10. heterozygotes at the DRD4 locus are more risk averse than either homozygotes PMID: 27905471
  11. We report an interaction between birth weight status and DRD4 gene in predicting respiratory sinus arrhythmia, such that DRD4 long carriers had the highest and lowest resting respiratory sinus arrhythmia depending on whether they were born normal or extremely low birth weight, respectively. PMID: 28727140
  12. DRD4 haplotypes may play a role in general psychopathology in patients with eating disorders PMID: 29455021
  13. Results indicated that DRD4 L carriers with a sexual trauma history reported significantly more severe suicidal ideation than DRD4S homozygotes. PMID: 27267123
  14. DRD4 x Positive peer affiliation interaction on the right fusiform gyrus (rFG) activation during successful inhibition. PMID: 27170266
  15. over-suppression of NMDAR function may underlie the role of hD4.7 in attention deficit hyperactivity disorder PMID: 27475724
  16. nine ADHD candidate single nucleotide polymorphisms (SNPs) in seven genes were tested for association with PD in 5333 cases and 12,019 healthy controls. No significant association was observed. PMID: 28176268
  17. Study analyzed the effects of DRD4 and DAT1, prenatal exposure to alcohol and smoking and their interactions on attention-deficit/hyperactivity disorder severity, response inhibition and brain activity; found no significant gene x environment interaction effects. PMID: 28234207
  18. this study determined crystal structures of the D4 dopamine receptor in its inactive state bound to the antipsychotic drug nemonapride, with resolutions up to 1.95 angstroms. PMID: 29051383
  19. Egyptian attention-deficit hyperactivity disorder (ADHD) children had a significant presence of DRD4 2-repeat allele with an absence of 7-repeat allele. Genotype-phenotype correlation indicated that DRD4 2-repeat and 4-repeat alleles were associated with significant inattention and hyperactivity whereas 3-repeat allele was associated with mild ADHD symptoms. PMID: 27821512
  20. We investigated genetic associations with reflexive attention measures in infancy and childhood in the same group of children. Performance on the infant task was associated with SLC6A3. In addition, several genetic associations with an analogous child task occurred with markers on CHRNA4, COMT, and DRD4. PMID: 26613685
  21. The results demonstrate Interaction between DBH gene variants and low enzymatic activity in male ADDH probands. The data obtained may partly answer the male biasness of ADDH Significant male preferential transmission of Dopamine receptor D4 was also observed. PMID: 23881560
  22. Children who carried DRD4 GA/AA genotypes (rs752306) were less likely than those who carried the DRD4 GG genotype to have attention-deficit/hyperactivity disorder. PMID: 29054088
  23. Many children who carry the 7R allele of DRD4 appear to be more in fl uenced by maternal sensitivity asit relates to overweight/obesity risk. PMID: 27726127
  24. Parenting and DRD4 variants GxE interaction in ADHD. PMID: 28138806
  25. Higher levels of antenatal maternal anxiety symptoms are associated with more frequent fetal movements among fetuses carrying a 7R allele, but not among fetuses carrying shorter DRD4 alleles. PMID: 27195896
  26. youth without the DRD4-7R allele were particularly affected by the school environment. PMID: 27786532
  27. C allele of SNP rs1800955 associated with cigarette smoking PMID: 28103253
  28. Infants carrying the DRD4 7R allele showed greater effects of maternal insensitivity than non-carriers for behavioral problems at 18-months. PMID: 27494520
  29. DRD4 exon 3 VNTR polymorphism is related to attention-deficit/ hyperactivity disorder in Chinese children. PMID: 28282463
  30. Adolescent rule-breaking is stronger for DRD4 non-long carriers. PMID: 27268567
  31. these findings suggest that in part genetically determined peer selection (carriers of the DRD4 seven-repeat allele tend to associate with peers who have more favorable attitudes toward drinking and greater alcohol use) and peer socialization (carriers' subsequent drinking behaviors are more strongly associated with their peer drinking norms) may differ across adolescent developmental stages. PMID: 26902782
  32. Results found that frequency of those carrying the DRD4 7 repeat allele continuously increased with age in a Caucasian population of Hungarians until age 75, and this was found preferentially for females. For the older groups, a decrease in 7 repeat carriers was noted which might be a result of a gene environment interaction. PMID: 27992450
  33. Mothers with long alleles for AVPR1a and DRD4 engaged in more mother-oriented social cognition, which in turn predicted less sensitive maternal behavior. There were no significant direct effects of AVPR1a or DRD4 on maternal sensitivity (beta = 0.02, P = .73 and beta = -0.10, P = .57, respectively). PMID: 27581946
  34. Parent and child dopamine D4 receptor (DRD4) genotypes jointly moderate the transactional relations between parenting practices and child self-regulation. PMID: 27548745
  35. dopamine D4 receptor carboxyl-terminal palmitoylation is required for surface expression, endocytosis, and signaling PMID: 27659709
  36. GxE interaction between DRD4 7R and family SES/neighborhood poverty, and the frequency of voluntary and involuntary job changes through educational achievement. PMID: 27077527
  37. the results of the present study demonstrated that elevated DRD4 promoter methylation was associated with AD risk in males. PMID: 27485706
  38. The results indicate that epigenetic regulation of the DRD4 gene in the form of increased methylation is associated with the cognitive/attentional deficits in ADHD. PMID: 26897359
  39. DRD4 antagonist has an antimelanogenic effect that is related to downregulation of MITF transcription through the activation of the ERK PMID: 26782007
  40. DRD4 7-repeat carriers with ADHD showed the least striatal activation during reward anticipation when exposed to high maternal warmth, but the most when exposed to low warmth. PMID: 27045841
  41. DRD4 gene expression reduction in breast cancer patients after spiritual intervention PMID: 26597879
  42. Polymorphisms of the DRD4 gene appear to be associated with SSRI treatment response in Chinese MDD patients. PMID: 25854875
  43. Community disadvantage interacted with parental DRD4 status to predict low levels of protective parenting. Protective parenting, in turn, interacted with youth DRD4 status to forecast increases in youth's planful future orientations, a proximal influence on changes in risk behavior. PMID: 26189764
  44. DRD4 and SLC6A3 gene polymorphisms may have a role in food intake and nutritional status in children in early stages of development PMID: 26350252
  45. There may be a specific molecular pathway by which the DRD4-521T genotype alters ACC electrophysiology and thereby predicts the level of problematic substance use in undergraduates. PMID: 26601911
  46. There were no significant interactions for DRD4 with parental support and psychological control with respect to development of adolescent delinquency. PMID: 26595468
  47. In contrast to previous results, we observed no significant interactions between DRD4 and childhood adversity in the etiology of alcohol dependence symptoms during emerging and young adulthood. PMID: 26595480
  48. findings thus reveal unreported structural determinants of the mutated DRD4 receptor and provide a robust framework for design of effective novel drugs. PMID: 26680992
  49. present findings suggest that DRD4L may be involved in the development of an intermediate phenotype specific to substance abuse. PMID: 26688118
  50. the putative involvement of DAT1 and DRD4 genes in the aetiology of Attention-deficit hyperactivity disorder with a main role in modulation of key dimensions of the disorder PMID: 25555995

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in retina. Detected at much lower levels in brain, in amygdala, thalamus, hypothalamus, cerebellum and pituitary.
Database Links

HGNC: 3025

OMIM: 126452

KEGG: hsa:1815

UniGene: Hs.99922

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1