Recombinant Human ER lumen protein retaining receptor 3(KDELR3)

Code CSB-CF012131HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O43731
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYN TVMKVVFLLCAYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLANWIRRYQTENFYDQIA VVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPMPI
Source in vitro E.coli expression system
Gene Names KDELR3
Protein Names Recommended name: ER lumen protein retaining receptor 3 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 3 Short name= KDEL receptor 3
Expression Region 1-214
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERD2 family
Database Links

HGNC: 6306

KEGG: hsa:11015

STRING: 9606.ENSP00000386918

UniGene: Hs.745072

Related Products

KDELR3 Antibodies

KDELR3 Antibodies for Homo sapiens (Human)

KDELR3 Proteins

KDELR3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.