Recombinant Human Epithelial membrane protein 1 (EMP1)

Code CSB-CF007648HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
EMP1
Uniprot No.
Alternative Names
EMP1; B4B; TMP; Epithelial membrane protein 1; EMP-1; CL-20; Protein B4B; Tumor-associated membrane protein
Species
Homo sapiens (Human)
Expression Region
1-157
Target Protein Sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. The abnormal expression of EMP-1 may be associated with progression of laryngeal carcinoma (LC) and the gene may act as a prognostic marker for LC. PMID: 28779068
  2. The studies implicating GAS3 protein family (EMP1, EMP2, EMP3 and PMP22) in cancer pathogenesis as well as probe the structural similarities between the family members were highlighted. PMID: 27279240
  3. Therefore, EMP1 is a tumor suppressor in laryngeal carcinoma. Boosting EMP1 expression in laryngeal carcinoma initiates multiple anticancer phenotypes and thus presents a promising therapeutic strategy for laryngeal cancer. PMID: 27909719
  4. SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1.EMP1 localises to tight junctions and is essential for their formation and function. PMID: 25394671
  5. Low EMP1 expression in colorectal cancer is associated with increased disease severity, suggesting that EMP1 may be a negative regulator of colorectal cancer PMID: 24744589
  6. Results demonstrated that EMP1 protein levels were significantly reduced in gastric carcinoma and were associated with tumor invasion, lymph node metastasis, clinical stage and cell differentiation. PMID: 24920167
  7. EMP1 as an independent predictor for poor outcome in precursor-B ALL (BCP-ALL) (P=0.004, hazard ratio: 2.36 (1.31-4.25). PMID: 24625531
  8. EMP-1 was significantly up-regulated in NSCLC patients. PMID: 23271282
  9. EMP1 expression decreased in prostate cancer and correlated significantly T stages, lymph node metastasis, clinic stage, and Gleason score PMID: 24338711
  10. EMP1 could be a biomarker for aberrant epithelial remodelling and metaplasia in chronic inflammatory upper airway mucosa PMID: 24033346
  11. EMP1 may play important roles as a negative regulator to nasopharyngeal cancer cell. PMID: 24292952
  12. EMP1 may play important roles as a negative regulator to breast cancer MCF-7 cell by regulating the expression of caspase 9 and VEGFC protein. PMID: 24402572
  13. Overexpression of EMP1 in spinal chondrocytes promotes cell proliferation and survival, alters cell morphology and cell cycle, reduces cell condensation, and inhibits cell hypertrophy. PMID: 21538935
  14. The EMP1 gene may be implicated in the pathophysiology of MDD in the Japanese population. PMID: 21146590
  15. Decreased expression of EMP1 was significantly correlated with clinical stage (p=0.002) and lymph node metastasis (p=0.044) of patients with oral squamous cell carcinoma and may be a tumor suppressor. PMID: 20980531
  16. EMP-1 gene has some relationship with carcinogenesis of esophagus. PMID: 12451984
  17. Overexpression of human EMP-1 gene can inhibit the proliferation of EC9706 cell with S phase arrested and G1 phase prolonged. EMP-1 may be one of regulators involved in cell signaling, cell communication and adhesion regulators. PMID: 12632483
  18. role of the adhesion molecule, EMP-1, as a biomarker of gefitinib clinical resistance, and further suggests a probable cross-talk between this molecule and the epidermal growth factor receptor signaling pathway PMID: 16087880
  19. We found expression of EMP-1 mRNA was higher in intractable epilepsy per the gene scanning, EMP-1 immunoreactivity was apparent in neurons of IE patients but not in the control group, and the expression of EMP-1 and EGFR occurred in the same neuron. PMID: 19288191

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
PMP-22/EMP/MP20 family
Database Links

HGNC: 3333

OMIM: 602333

KEGG: hsa:2012

STRING: 9606.ENSP00000256951

UniGene: Hs.719042

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1