Recombinant Human G-protein coupled receptor 182 (GPR182)

Code CSB-CF009791HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GPR182
Uniprot No.
Alternative Names
GPR182; ADMR; G-protein coupled receptor 182
Species
Homo sapiens (Human)
Expression Region
1-404
Target Protein Sequence
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALY LAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWL WGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVL SAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVL TACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYF FYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHS IIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Orphan receptor.
Gene References into Functions
  1. Our data demonstrate that GPR182 is an endothelial subtype-specific marker for human sinusoidal EC of the liver, spleen, lymph node and bone marrow. In addition, we provide evidence for GPR182-dependent downstream signaling via ERK and SRF pathways that may be involved in regulating endothelial subtype-specific sinusoidal differentiation and sinusoidal functions such as permeability. PMID: 29408502
  2. Gene expression of adrenomedullin receptor components are differentially regulated in the uterus during the estrous cycle. PMID: 23442365
  3. ADMR mediates the stimulatory effects of adrenomedullin on cancer cells and on endothelial and stellate cells within the tumor microenvironment PMID: 19847298
  4. Endogenous ADM system plays a potentially important role in the paracrine or autocrine functional control of Conn's adenomas. PMID: 11712085
  5. The cardiovascular response in sepsis: proposed mechanisms of the beneficial effect of adrenomedullin and its binding protein (review). PMID: 11956648
  6. The co-expression of Adm and its receptor in perineural fibroblasts and the expression of an Adm receptor in Schwann cells suggest autocrine and/or paracrine modes of action of Adm in peripheral nerves. PMID: 12419522
  7. Chondrocyte phenotype cells expressed adrenomedullin and the adrenomedullin receptor, and secreted high concentration of adrenomedullin into the culture medium PMID: 12646214
  8. Hybridization in situ showed that ADMR mRNA expression was significantly higher in pulmonary artery walls in patients with chronic obstructive pulmonary disease. PMID: 14720432
  9. distribution of adrenomedullin receptor (AM-R )in the villous and extravillous trophoblast cells of the placenta and in chorion and decidua cells of the fetal membranes changed with gestational age but not with labor PMID: 17939601
  10. This putative G protein-coupled receptor remains an orphan, as the ability to bind and be activated by adrenomedullin has been refuted. A complex of CRLR and RAMP2 or RAMP3 gives a functional adrenomedullin receptor. PMID: 9535752

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver.
Database Links

HGNC: 13708

OMIM: 605307

KEGG: hsa:11318

STRING: 9606.ENSP00000300098

UniGene: Hs.483909

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X