Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF009814HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | O15529 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Sequence | MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLRCRPVAVDVLLLNLTAS DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFWKDQLAI LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLVAATLLNFLVCFGP YNVSHVVGYICGESPVWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAEN |
| Source | in vitro E.coli expression system |
| Gene Names | GPR42 |
| Protein Names | Recommended name: G-protein coupled receptor 42 |
| Expression Region | 1-346 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | Full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Probable G protein-coupled receptor that may be activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that may play a role in the regulation of whole-body energy homeostasis and/or in intestinal immunity. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Database Links |
HGNC: 4500 OMIM: 603822 KEGG: hsa:2866 STRING: 9606.ENSP00000410925 |
GPR42 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008940 | GPR42 Antibody | Human | IF,ELISA |
GPR42 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP009814HU1 CSB-EP009814HU1 CSB-BP009814HU1 CSB-MP009814HU1 |
Recombinant Human G-protein coupled receptor 42(GPR42),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Rat Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase(LIPA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Neuroendocrine convertase 2(Pcsk2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Visinin-like protein 1(VSNL1)
Express system: E.coli
Species: Homo sapiens (Human)
