Recombinant Human Galanin receptor type 3(GALR3)

Code CSB-CF009225HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O60755
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG GEAARGPE
Source in vitro E.coli expression system
Gene Names GALR3
Protein Names Recommended name: Galanin receptor type 3 Short name= GAL3-R Short name= GALR-3
Expression Region 1-368
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the hormone galanin
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 4134

OMIM: 603692

KEGG: hsa:8484

STRING: 9606.ENSP00000249041

UniGene: Hs.158353

Related Products

GALR3 Antibodies

GALR3 Antibodies for Homo sapiens (Human)

GALR3 Proteins

GALR3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.