Recombinant Human Gastrin/cholecystokinin type B receptor (CCKBR)

Code CSB-CF004773HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CCKBR; CCKRB; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Species
Homo sapiens (Human)
Expression Region
1-447
Target Protein Sequence
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL PDEDPPTPSIASLSRLSYTTISTLGPG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.; Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.
Gene References into Functions
  1. We concluded that low serum gastrin is related to increased risk of ER(+) BC development. The results also established that CCKBR/ERK/P65 signaling function is generally tumor suppressive in ER(+) BC, indicating therapies should focus on restoring, not inhibiting, CCKBR/ERK/P65 pathway activity. PMID: 30115027
  2. High CCK2R expression is associated with cancer. PMID: 26910279
  3. These results suggest that Z-360 exerts an anti-tumor effect through a reduction in anti-apoptosis factors by blocking CCK2R PMID: 28739697
  4. High CCK-BR expression is associated with Gastric Cancer. PMID: 27518872
  5. There is no identifiable link between nuclear CCK2R expression and all the clinicopathological characteristics examined in a cohort of Taiwanese colon cancer patients. PMID: 26508021
  6. Data indicate that variant c.811+32C>A in cholecystokinin-B receptor gene (CCKBR) does not have a significant impact on pancreatic cancer risk or survival in a Hungarian cohort. PMID: 26646278
  7. This study showed that CCK2 receptors were highly expressed within the cytoplasmic area of cancerous cells, whereas the levels were very low in normal tissues. PMID: 26520651
  8. CCK-BR SNP predicts survival and should be studied as a candidate genetic biomarker for those at risk of pancreatic cancer. PMID: 25469546
  9. treatment with gastrin, a CCK2R agonist, stimulated the secretion of GLP-1, and that this effect was likely due to increased expression of proglucagon and PCSK1 (also known as prohormone convertase 3 (PC3 gene)). PMID: 25601282
  10. Our results indicate a promoting role of CCK2R on GIST tumourigenesis, particularly in tumours of gastric origin. PMID: 22786615
  11. The gastrin receptor is a promising tumor cell surface target for future prostate-cancer-specific imaging applications. PMID: 24211650
  12. DeltaFosB induction in prelimbic area occurred selectively in susceptible mice after chronic social defeat stress and produced these effects partly through induction of the cholecystokinin (CCK)-B receptor. PMID: 24623766
  13. some CCKBR polymorphisms may contribute to an underlying predisposition towards suicidal behaviour in bipolar disorder. PMID: 23890582
  14. Gastric mucosal injury with H. pylori infection destroys the pH barrier on the foveolar epithelium and may induce gastrin receptor expression through pH changes. PMID: 23053898
  15. Suggest that CCK2R-mediated COX-2 up-regulation via JAK2/STAT3/PI3K/Akt pathway is involved in the proliferative effect of gastrin on human gastric cancer cells. PMID: 23376640
  16. Data suggest that mutations in cholecystokinin 2 receptor (CCK2R) may promote tumorigenesis through deregulated receptor activity and highlight the importance of evaluating CCK2R inhibitors to block both the normal and mutant forms of the receptor. PMID: 22516348
  17. These results show the importance of the CCK-BR in regulation of growth and apoptosis in pancreatic cancer. PMID: 22442157
  18. A novel splice variant acting as a dominant negative on membrane density of the CCK2R may be of importance for the pathophysiology of certain tumors and for their in vivo CCK2R-targeting. PMID: 22040601
  19. A single nucleotide polymorphism in the cholecystokinin-B receptor that alters splicing predicts survival in pancreatic cancer. PMID: 22277584
  20. proximal DNA elements within the human gastrin gene promoter mediate interactions between JunD, which induces gastrin gene expression and menin, which suppresses JunD-mediated activation. PMID: 21852362
  21. Genetic polymorphisms in cholecystokinin B receptor may play a role in antipsychotic induced weight gain in schizophrenia patients. PMID: 20732371
  22. Regulation of membrane cholecystokinin-2 receptor by agonists enables classification of partial agonists as biased agonists. PMID: 21156802
  23. a positive-feedback loop whereby gastrin, acting via the CCK2 receptor, increases its own expression PMID: 20932834
  24. The CCK(2)splice variant with retention of intron 4 (Ri4sv) is a marker of specific gastrointestinal and lung tumours. PMID: 19627395
  25. The cholecystokinin 2 receptor allele with 21 CT repeats was associated with multiple chemical sensitivity when compared in post hoc analyses with all individuals from the population sample. PMID: 20185366
  26. Results show that signaling through ACAT/cholesterol esterification is a novel pathway for the CCK2R that contributes to tumor cell proliferation and invasion. PMID: 19502590
  27. Expression of gastrin and cholecystokinin 2 (CCK(2)) receptor splice variants are upregulated in human colonic adenomas where they are thought to contribute to tumor growth and progression. PMID: 19697327
  28. A misspliced form of the cholecystokinin-B/gastrin receptor in pancreatic carcinoma: role of reduced sellular U2AF35 and a suboptimal 3'-splicing site leading to retention of the fourth intron. PMID: 11830556
  29. hGARE is proposed as a new candidate target gene in microsatellite instability tumorigenesis. PMID: 11896205
  30. role in activating protein kinase D2 PMID: 12058027
  31. Hyper-gastrinaemia may promote proliferation of human colonic adenomas that expressnon-truncated CCK-2 receptor isoforms. PMID: 12189558
  32. data represent the first evidence for role in regulating cell-cell and cell-substrate adhesion and support a role in the progression of carcinoma PMID: 12400008
  33. data support the hypothesis that cholecystokinin-B receptor mediated activation of the hypothalamic-pituitary-adrenal axis is relatively resistant to cortisol feedback inhibition PMID: 12510010
  34. induction by oncogenic ras in LoVo and Colo320HSR colon cancer cell lines PMID: 12761477
  35. Cholecystokinin-A receptor and B receptor polymorphisms, considered alone, showed no correlation with hallucinations in Parkinson's disease PMID: 12777967
  36. this is the first report that provides evidence for the high tumorigenic effect of a constitutively active CCK2R mutant, thus raising a potential role of the CCK2R in human cancer. PMID: 12955087
  37. findings suggest physiological functions for the CCK(2)R in calcitonin-secretion and gene expression as well as a pathophysiological role in medullary thyroid carcinoma proliferation PMID: 14759564
  38. CCK exerts secretagogue action on human ZG cells, acting through CCK2-Rs coupled to the adenylate cyclase/protein kinase A signaling cascade PMID: 15001623
  39. A role is implicated for the CCKB receptor gene in suicide completers, the highest gene expression being observed in the cerebellum followed by cingulate gyrus and pre-frontal cortex compared to their age and sex-matched controls. PMID: 15036586
  40. Gastrin/CCK-B receptor autocrine or paracrine pathway may possibly play an important role in the progression of gastric cancer. PMID: 15040018
  41. CCK2i4svR, a splice variant of cholecystokinin-2 receptor, has a role in agonist-independent activation of Src tyrosine kinase PMID: 15292208
  42. Findings are consistent with the notion that genetic variation in the CCK B receptor neurotransmitter system contributes to the pathogenesis of panic disorder. PMID: 15354400
  43. the MEK1/ERK1/2 pathway couples the CCK2 receptor to nuclearization and DNA binding of Egr-1 PMID: 15611055
  44. analysis of interspecies polymorphism in the human and rat cholecystokinin receptor-2 and its effect on the cholecystokinin binding site PMID: 15817487
  45. Photoaffinity labeling of the type B CCK receptor provides evidence for the peptide-binding domain to include receptor loop and amino-terminal tail regions residing at the extracellular surface of the plasma membrane. PMID: 15850403
  46. human normal, inflammatory, and malignant gastric tissues simultaneously express the classical and alternative splicing cholecystokinin-B/gastrin receptor genes PMID: 15989082
  47. Study confirms that a high proportion of gastric cancer tissue samples express the gastrin/CCKB receptor, which can stimulate the growth of gastrin/CCKB receptor-positive gastric cancer cells. PMID: 16012719
  48. CCK2 gastrin receptor may have a role in leukemia PMID: 16142371
  49. Gastrin exerts an antiproliferative and proapoptotic effect on human colon cancer cells expressing the wild-type CCK2 receptor. PMID: 16143134
  50. The expression rates of gastrin and gastrin receptor are high (about a half) in gastric carcinoma tissues, and there is an association between gastrin and gastrin receptor expression. PMID: 16228228

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the smal
Database Links

HGNC: 1571

OMIM: 118445

KEGG: hsa:887

STRING: 9606.ENSP00000335544

UniGene: Hs.203

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1