Recombinant Human Glycerophosphodiester phosphodiesterase domain-containing protein 5 (GDPD5)

Code CSB-CF823875HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GDPD5
Uniprot No.
Alternative Names
GDPD5; GDE2; PP6037; PP9363; UNQ1850/PRO3580; Glycerophosphodiester phosphodiesterase domain-containing protein 5; Glycerophosphocholine phosphodiesterase GDPD5; Glycerophosphodiester phosphodiesterase 2; Phosphoinositide phospholipase C GDPD5
Species
Homo sapiens (Human)
Expression Region
1-605
Target Protein Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLTWLY FWWEVHNDYDEFNWYLYNRMGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNL HWLHKIGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGAVAAVTMLSWIVA GQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA PEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML NWTTLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLR DPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHA LSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVR RTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSHTKTLI ERSGR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glycerophosphodiester phosphodiesterase that promotes neurite formation and drives spinal motor neuron differentiation. Mediates the cleavage of glycosylphosphatidylinositol (GPI) anchor of target proteins: removes the GPI-anchor of RECK, leading to release RECK from the plasma membrane. May contribute to the osmotic regulation of cellular glycerophosphocholine.
Gene References into Functions
  1. Data suggest that GDE2/gdpd5 play roles in pancreatic organogenesis; gdpd5 knockdown leads to defects in differentiation of pancreas in zebrafish embryos; studies with recombinant fusion proteins suggest similar roles for homologous human GDE2 and zebrafish gdpd5. PMID: 29203233
  2. miR-195-5p is a potent suppressor of GDPD5 and that, as such, it significantly increases chemosensitivity and apoptosis in chemoresistant colorectal cells. PMID: 29635904
  3. GDPD5 expression is strongly associated with favorable outcome in neuroblastoma. GDE2 induces differentiation of neuroblastoma cells, suppresses cell motility, and opposes RhoA-driven neurite retraction. PMID: 27693046
  4. Identification of GDPD5 as a glycerophosphocholine phosphodiesterase that probably participates in the regulation of choline phospholipid metabolism in breast cancer. PMID: 22279038
  5. GDPD5 was widely expressed in human tissues and the expression levels in kidney and prostate were relatively low PMID: 17578682

Show More

Hide All

Subcellular Location
Endomembrane system; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cell projection, growth cone.
Protein Families
Glycerophosphoryl diester phosphodiesterase family
Database Links

HGNC: 28804

OMIM: 609632

KEGG: hsa:81544

STRING: 9606.ENSP00000337972

UniGene: Hs.503297

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×