Recombinant Human Hyaluronan synthase 2 (HAS2)

Code CSB-CF010140HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
HAS2
Uniprot No.
Alternative Names
HAS2; Hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
Species
Homo sapiens (Human)
Expression Region
1-552
Target Protein Sequence
MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI DGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKS ICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSVWFTILLGGVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRR KKGQQYDMVLDV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.
Gene References into Functions
  1. hyaluron synthase 2 has a role in stem cell senescence PMID: 27339908
  2. COX-2, GREM1, and HAS2 are cumulus cell genes that potentially determine oocyte and embryo developmental competence. (Review) PMID: 29537212
  3. HAS2 may be a critical regulator of the fate of pulmonary fibrosis and we propose a model where over-expression of HAS2 promotes an invasive phenotype resulting in severe fibrosis and down-regulation of HAS2 promotes resolution. PMID: 26987798
  4. Results show that cancer-associated fibroblasts (CAFs) expresses higher levels of HAS2 and suggest that HAS2 is one of the key regulators responsible for CAF-mediated oral squamous cell carcinoma progression by modulating the balance of MMP1 and TIMP1. PMID: 27884164
  5. Results demonstrate that hypoxia induces HAS2 expression and thereby HA production, which contributes to EMT of oral squamous cell carcinoma. This process is mediated by HAS2-AS1, which can bind to HAS2 gene inducing its transcription. PMID: 28485478
  6. We identified HAS2, tumor cell-derived hyaluronic acid (HA) and ZEB1 to form a positive feedback loop as ZEB1, elevated by HA, directly activates HAS2 expression in breast cancer PMID: 28086235
  7. The present data reveal a selective up-regulation of HAS2 expression by extracellular Uridine Triphosphate, which is likely to contribute to the previously reported rapid activation of hyaluronan metabolism in response to tissue trauma or ultraviolet radiation. PMID: 28188289
  8. HAS2 and HAS3 were the only hyaluronan synthases detected, the expression of which was almost similar in NPs and NM. PMID: 26661071
  9. HAS2 has been proposed to be a target for therapeutic intervention in cancer. Our findings suggested a possible antagonistic role of androgen receptor (AR) pathway on HAS2 function. PMID: 27169756
  10. HAS-2 gene silencing may inhibit proliferation and promote apoptosis in the MCF-7 human breast cancer cell line. PMID: 27915342
  11. Our study establishes HAS2-mediated HA synthesis as a driver of growth of bladder cancer with low AGL and provides preclinical rationale for personalized targeting of HAS2/HA signaling in patients with low amylo-alpha-1-6-glucosidase-4-alpha-glucanotransferase -expressing tumors. PMID: 26490312
  12. HAS2-HA system influences the biological characteristics of human breast cancer cells PMID: 26722395
  13. Our study identified HAS2 as a novel candidate gene for susceptibility to adult asthma. PMID: 25251750
  14. In contrast to other carcinoma subtypes, HAS2 expression was observed in up to 72.7% of metaplastic carcinomas of breast, a carcinoma subtype related to the epithelial-mesenchymal transition. PMID: 24527698
  15. review of the roles of HAS2 and CD44 in breast tumorigenesis [review] PMID: 25081531
  16. mir-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging. PMID: 25264594
  17. HAS2 may be involved in the etiology of non-syndromic VSD and have the vital function in the development of heart septum PMID: 24558368
  18. Stimulation with LPS caused rapid increases in versican mRNA and protein, a rapid increase in Has1 mRNA, and concomitant inhibition of hyaluronidases 1 and 2, the major hyaluronan degrading enzymes PMID: 24472738
  19. UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2. PMID: 24847057
  20. Melanoma cell-derived factors stimulate hyaluronan synthesis in dermal fibroblasts by upregulating HAS2 through PDGFR-PI3K-AKT and p38 signaling PMID: 22825838
  21. findings suggested that rs2046571 of the HSA2 has marginal association with PD in Chinese population. PMID: 23916661
  22. HAS2 knockdown sensitizes cancer cells to radiation via persistent DNA damage. PMID: 24333416
  23. Inhibition of miR-21 has no effect on thrombospondin (TSP)-1-stimulated expression of HAS2. PMID: 24314882
  24. Data suggest that expression of HAS2 is lower in trophoblasts from first-trimester placenta of miscarriage then of normal subjects; the products of HAS2 (high/medium MW hyaluronan) promote cell proliferation/invasion and inhibit apoptosis. PMID: 23806178
  25. Data indicate that oxLDL doubled the transcripts of hyaluronan synthases HAS2 and HAS3 and hyaluronan deposition via the scavenger receptor LOX-1. PMID: 23979132
  26. The results from these experiments suggest that downregulation of HAS2 may be responsible for inhibition of hyaluronate synthesis in the self-assembled 2-nM T3 human dermal matrix. PMID: 23397370
  27. HAS 2 may be a potential therapeutic target for the treatment of oral cavity cancer PMID: 22473523
  28. COL6A1 and COL6A2 silencing downregulates HAS2 expression in Down syndrome fibroblasts. PMID: 23452080
  29. no significant difference (P > 0.05) was found between the level of HAS2 synthesized by control cells and NCTC 2544 cells treated with Plantaricin A preparations PMID: 22742591
  30. polymorphisms in HAS2 are potentially involved in glaucomatous neurodegeneration. PMID: 22960332
  31. Role of UDP-N-acetylglucosamine (GlcNAc) and O-GlcNAcylation of hyaluronan synthase 2 in the control of chondroitin sulfate and hyaluronan synthesis. PMID: 22887999
  32. We identified a previously unknown downstream target of beta-catenin, HAS2, in prostate cancer PMID: 22298898
  33. Findings show a critical role of HAS2 in the development of a prometastatic microenvironment. PMID: 22113945
  34. The difference in control of HAS2 expression allows the activation of one of the mechanisms underlying Graves ophthalmopathy, adipogenesis, to be linked biologically with the second, Hyaluronan overproduction. PMID: 22162480
  35. Hyaluronan synthase 2 (HAS2) promotes breast cancer cell invasion by suppression of tissue metalloproteinase inhibitor 1 (TIMP-1) PMID: 22016393
  36. HAS2-HYAL2/CD44 system may support spontaneous chemokinesis of human cancer cells through self-degradation of HMW-HA to produce LMW-HA by an autocrine mechanism. PMID: 21743962
  37. pulsatile, arterial-like shear stress conditions induced enzyme and hyaluronan effectively, while lower shear stress that continuously changed its direction did not induce any differences in comparison with control cultures not exposed to shear stress. PMID: 21551265
  38. Altered binding of SP1 and YY1 to the promoter correlated with cellular UDP-N-acetylhexosamines content and inhibition of HAS2 expression. PMID: 21795679
  39. transcriptional induction of HAS2-AS1 and HAS2 occurs simultaneously in PTCs and suggest that transcription of the antisense RNA stabilizes or augments HAS2 mRNA expression in these cells via RNA/mRNA heteroduplex formation. PMID: 21357421
  40. The combined HAS2-HYAL-1 biomarker detected bladder cancer and significantly predicted its recurrence. PMID: 20960509
  41. Hyaluronan synthesis is inhibited by adenosine monophosphate-activated protein kinase through the regulation of HAS2 activity in human aortic smooth muscle cells. PMID: 21228273
  42. interleukin 1beta and tumor necrosis factors alpha and beta, but not transforming growth factors alpha and beta, strongly induced HA synthesis by NF-kappaB pathway, activating hyaluronan synthase 2 PMID: 20522558
  43. Upregulation of HAS2 expression via EP(2) and IP receptors might contribute to the accumulation of HA during human atherosclerosis, thereby mediating proatherosclerotic functions of COX2. PMID: 14752026
  44. Base sequence of this gene's promoter is sequenced. PMID: 14988410
  45. Fusion with PLAG1 protein in lipoblastoma. PMID: 15642402
  46. IL-1beta induction of HAS2 expression involves multiple signaling pathways that act in concert, thus leading to an increase in expression of hyaluronan by jejunum-derived mesenchymal cells PMID: 15677552
  47. Has2 gene is a potent primary EGF and all-trans-RA responding gene with a complex regulation PMID: 15722343
  48. natural antisense mRNAs of HAS2 may have an important and novel regulatory role in the control of HAS2, hyaluronan biosynthesis, and HA-dependent cell functions PMID: 15843373
  49. Antisense inhibition of HAS2 in osteosarcoma cells inhibits hyaluronan retention and tumorigenicity. PMID: 15922739
  50. Sp1 and Sp3 are principal mediators of HAS2 constitutive transcription PMID: 16603733

Show More

Hide All

Involvement in disease
A chromosomal aberration involving HAS2 may be a cause of lipoblastomas, which are benign tumors resulting from transformation of adipocytes, usually diagnosed in children. 8q12.1 to 8q24.1 intrachromosomal rearrangement with PLAG1.
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
NodC/HAS family
Tissue Specificity
Expressed in fibroblasts.
Database Links

HGNC: 4819

OMIM: 601636

KEGG: hsa:3037

STRING: 9606.ENSP00000306991

UniGene: Hs.159226

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1