Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1)

Code CSB-CF011024HU
Abbreviation Recombinant Human IFITM1 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-125aa
Target Protein Sequence
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV and SARS-CoV-2 S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Inhibits SARS-CoV-2 S protein-mediated syncytia formation. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome.
Gene References into Functions
  1. Strong ifitm1 Expression in CD4 T Cells in HIV Controllers Is Correlated With Immune Activation PMID: 27552157
  2. Using a multi-group heat map from GSE9716 analysis of the GEO database, IFITM1 was determined to be a relevant radioresistance gene. Inhibition of IFITM1 in combination with radiotherapy could, indeed, inhibit oral neoplasm cells. PMID: 29770536
  3. Inactivated viral particle inoculation increased the expression of IFITM1protein at mRNA and protein levels, and mediated the antiviral state in HUVECs. PMID: 29100522
  4. Identification of three distinct mutations that converted IFITM1 or IFITM3 from inhibitors to enhancers of MERS-CoV or SARS-CoV spike protein-mediated entry revealed key structural motifs or residues determining the biological activities of IFITM proteins. PMID: 29263263
  5. Epithelial-mesenchymal transition (EMT) signature was dysregulated by both loss and gain of function of IFITM1, which was partially reverted by Caveolin-1 (CAV1). PMID: 27852071
  6. These results indicate that IFITM1 protein can restrict alphavirus infection by inhibiting viral fusion with cellular membranes. PMID: 27219333
  7. The transcriptional regulation of IFITM1, 2 and 3 expression. PMID: 28511927
  8. IFITM1 and IFITM3 inhibit Zika virus infection early in the viral life cycle. PMID: 27268505
  9. IFITM1 suppression blocks proliferation and invasion of aromatase inhibitor-resistant breast cancer in vivo by JAK/STAT1-mediated induction of p21. PMID: 28411130
  10. Compared with CD10, IFITM1 has superior performance distinguishing endometrial stroma of adenomyosis from mesenchyma surrounding invasive endometrial adenocarcinoma. PMID: 27124937
  11. Overexpression of IFITM1 is associated with Oral Squamous Cell Carcinomas. PMID: 27221933
  12. High expression of IFITM1 is associated with poor prognosis of colorectal cancer. PMID: 26884876
  13. These findings indicate that overexpression of IFITM1 enhances the aggressive phenotype of triple-negative SUM149 IBC cells and that this effect is dependent on STAT2/BRG1 interaction. PMID: 26897526
  14. propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific PMID: 26354436
  15. the importance of the C-terminal region of IFITM1 in modulating the antiviral function through controlling protein subcellular localization. PMID: 25738301
  16. Suggest that IFITM1 promotes the aggressiveness of colorectal cancer cells via caveolin-1 signaling. PMID: 26259513
  17. In virus-producing cells, IFITMs coalesce with forming virions and are incorporated into HIV-1 viral particles. PMID: 25422070
  18. Incorporation of IFITM1, IFITM2 and IFITM3 into HIV-1 virions impair viral fusion and spread. PMID: 25464829
  19. Host IFITM3,IFITM2 and IFITM1 facilitate morphogenesis of the human cytomegalovirus assembly. PMID: 25552713
  20. Schizophrenia subjects with higher IFITM mRNA levels in cortical blood vessels have greater disturbances in cortical GABA neurons suggests that these cell-type disturbances might be influenced by a shared upstream insult that involves immune activation. PMID: 24209773
  21. IFITM1 could be a novel metastasis-promoting gene that enhances the metastatic phenotype in ovarian cancer via epigenetic transcriptional regulation. PMID: 24676393
  22. IFITM1 is a potential valuable addition to immunohistochemical panels used in the diagnosis of cellular mesenchymal uterine tumors. PMID: 24072182
  23. Results suggest that the g.-1920G>A polymorphism in interferon inducible transmembrane protein 1 (IFITM1) may be associated with susceptibility to ulcerative colitis (UC). PMID: 24120510
  24. IFITM1 is essential for the formation of functional blood vessels and stabilizes EC-EC interactions during endothelial lumen formation by regulating tight junction assembly. PMID: 24603679
  25. Although their inhibitory activities were modest when compared to that of tetherin, IFITMs, but not tetherin, directly reduced the expression of HIV-1 proteins including Gag, Vif and Nef. PMID: 23376165
  26. Authors show that interferon-induced transmembrane protein 1 (IFITM-1), IFITM-2, and IFITM-3 exhibit a broad spectrum of antiviral activity against several members of the Bunyaviridae family. PMID: 23720721
  27. This study defines IFITM1 as an interferon-stimulated gene effector with action against HCV entry. PMID: 22996292
  28. IFITM1 knockdown in human alveolar-derived bone marrow stromal cells was associated with inhibition of Runx2 mRNA and protein expression. PMID: 22634173
  29. Introduction of anti-miR-130a in hepatocytes increased IFITM1 expression. Hepatocytes stably expressing IFITM1 reduced HCV replication. Together, these results suggested that HCV infection of hepatocytes upregulates miR-130a. PMID: 22787204
  30. The results suggest that the expression of IFITM1 controls the invasiveness and migration of gastric cancer. PMID: 22609115
  31. Hepatitis C virus infection suppresses the upregulation of a subset of effector molecules, including ISG56 and IFITM1. PMID: 21976647
  32. IFITM1 was expressed in the five human glioma cell lines, and its expressions were positively correlated with their tumorigenicity PMID: 20838853
  33. IFITM proteins differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. PMID: 21253575
  34. IFITM1, IFITM2, and IFITM3 inhibit HIV-1 replication through interfering with virus entry. PMID: 21177806
  35. Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity. PMID: 20220060
  36. Activated IFITM1 is associated with Peutz-Jeghers syndrome polyps. PMID: 20428811
  37. Down regulation of IFITM1 is associated with cervical squamous cell carcinoma. PMID: 20099975
  38. The positive expression level of IFITM1 is associated with the progression of the carcinogenetic process in Peutz-Jeghers syndrome. PMID: 19304549
  39. LEU13 has a novel role different from that in the inhibition of cell proliferation, involved in IFNA-induced refractoriness of RSa cells to X rays PMID: 12926988
  40. IFITM1 expression profiling could be used for molecular classification of CML, which may also predict survival PMID: 15661263
  41. Overexpression of 9-27 leads to increased migration and invasiveness by suppressing natural killer cells in gastric cancer PMID: 15808405
  42. IFITM1 has a role in cellular sensitivity to CDDP in esophageal cancer PMID: 18202764
  43. IFITM1 plays an important role for the invasion at the early stage of HNSCC progression PMID: 18829488
  44. results revealed that the interaction between IFITM1 and CAV-1 could enhance the inhibitory effect of CAV-1 on ERK activation PMID: 19499152
  45. Antiviral effect of IFITM family members on H1N1 influenza, West Nile virus, and Dengue virus PMID: 20064371

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass membrane protein. Lysosome membrane.
Protein Families
CD225/Dispanin family
Tissue Specificity
Bone (at protein level). Levels greatly elevated in colon cancer, cervical cancer, esophageal cancer and ovarian cancer. Expressed in glioma cell lines.
Database Links

HGNC: 5412

OMIM: 604456

KEGG: hsa:8519

STRING: 9606.ENSP00000330825

UniGene: Hs.458414

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*