Recombinant Human Killer cell immunoglobulin-like receptor 2DL1 (KIR2DL1)

Code CSB-CF012352HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
KIR2DL1; CD158A; NKAT1; Killer cell immunoglobulin-like receptor 2DL1; CD158 antigen-like family member A; MHC class I NK cell receptor; Natural killer-associated transcript 1; NKAT-1; p58 natural killer cell receptor clones CL-42/47.11; p58 NK receptor CL-42/47.11; p58.1 MHC class-I-specific NK receptor; CD antigen CD158a
Species
Homo sapiens (Human)
Expression Region
22-348
Target Protein Sequence
HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor on natural killer (NK) cells for some HLA-C alleles such as w4 and w6. Inhibits the activity of NK cells thus preventing cell lysis.
Gene References into Functions
  1. KIR 2D (L1, L3, L4, S4) and KIR 3DL1 expression was correlated with poor prognosis in non-small cell lung carcinoma patients. PMID: 27893413
  2. A negative association between the KIR2DL1 polymorphism and susceptibility to type 1 diabetes mellitus was found. PMID: 29384924
  3. the surface organization of paired killer Ig-like receptors (KIR), KIR2DL1 and KIR2DS1, on human primary natural killer cells and cell lines, was examined. PMID: 27210755
  4. A significantly higher risk of chronic rejection after kidney transplantation was observed when recipient (r) and donor (d) pairs completely lacked the two functional rKIR-dHLA ligand combinations rKIR2DL1/dHLA-C2 and rKIR3DL1/dHLA-Bw4. PMID: 28686681
  5. CD16+ cells were significantly more frequent among Natural Killer (NK) cells negative for the inhibitory KIR (iKIR) KIR2DL1, KIR2DL3, and KIR3DL1 than those positive for any one of these iKIR to the exclusion of the others, making iKIR+ NK cells poorer antibody dependent cellular cytotoxicity effectors than iKIR- NK cells. PMID: 27732638
  6. Data indicate that a novel variant allele, KIR2DL1*031, was identified by cDNA cloning and haplotype sequencing of killer cell immunoglobulin-like receptor 2DL1 (KIR2DL1) gene. PMID: 27577226
  7. KIR2DL1-C2C2 is less frequent in type 1 diabetes in Saudi children PMID: 26542066
  8. Influence of Differently Licensed KIR2DL1-Positive Natural Killer Cells in Transplant Recipients with Acute Leukemia PMID: 26456260
  9. Educated natural killer cells expressing KIR2DL1 display functional advantage for anti-HIV-1 antibody-dependent activation. PMID: 26647083
  10. KIR2DL1*022 and 2DL1*026 evolved in the KhoeSan after their divergence from other modern human populations. PMID: 26292085
  11. Data suggest regulatory interactions between major histocompatibility antigen HLA-C and killer cell Ig-like receptor (KIR) might promote Graft-versus-Leukemia effects following transplantation. PMID: 26416275
  12. Coengagement of inhibitory receptors, either KIR2DL1 or CD94-NKG2A, did not inhibit phosphorylation of Stat5 but inhibited selectively phosphorylation of Akt and S6 ribosomal protein. PMID: 26453750
  13. genetic association studies in Chinese Han population: Data suggest that the frequency of KIR2DL1 gene is increased in women with pre-eclampsia when homozygous HLA-C2 allele appears in the fetus. PMID: 24951171
  14. Array CGH showed a 95 Kb de novo duplication on chromosome 19q13.4 encompassing four killer cell immunoglobulin-like receptor (KIR) genes. PMID: 23952617
  15. These results revealed that ITIM phosphorylation is controlled by self-association of KIR and that His-36 serves as a gatekeeper to prevent unregulated signaling through KIR2DL1. PMID: 25505289
  16. C2 of KIR2DL1 is a novel risk factor, and homozygosity for C1 is a protective factor for childhood B-ALL PMID: 25163702
  17. We investigated the association of HLA alleles and KIR ligands according to oligoclonal band status in multiple sclerosis patients. PMID: 25037176
  18. Our findings suggest KIR2DL1(+)-HLA-C2(+) genotype as heritable risk factor in oral squamous cell carcinoma (OSCC) predisposing to OSCC at a younger age. PMID: 24818561
  19. Normal NK CD158a expression is associated with successful IVF and pregnancy. PMID: 23951916
  20. Donor KIR2DL1 allelic polymorphism affects recipient outcomes after allogeneic hematopoietic stemm cell transplantation. PMID: 24043749
  21. Data indicate that positive linkage disequilibrium was observed between KIR3DL1, 2DL1, 2DL3 and 2DS4 which is consistent with the associations between the constituents of A haplotypes. PMID: 23354323
  22. NK cells were isolated from peripheral blood and the lysis of KG1A and K562 cells by the NK cells was analyzed to investigate whether KIR2DL1 expression on NK cells would affect the cytotoxicity. PMID: 23865361
  23. cytomegalovirus positive had lower proportions of NK-cells expressing inhibitory receptors (KLRG1 and CD158a) PMID: 21933704
  24. DNA-demethylating treatment with 5-azacytidine resulted in re-expression of kir2DL1 gene and increased expressions of kir2DL1, kir2DL2 and kir2DL3 genes in NK-92MI cells. PMID: 19549382
  25. Results demonstrate that receptor-ligand dimensions, NKG2D/MICA and KIR2DL1/HLA-C, are important in NK cell recognition. PMID: 21179506
  26. supervillin is a novel molecule that associates with KIR2DL1 receptor and regulates the inhibitory signaling in NK cells. PMID: 21070852
  27. Inhibitory receptor KIR2DL1 in combination with HLA-C2 ligand confers susceptibility to chronic hepatitis B (CHB), whereas inhibitory receptor KIR2DL3 or KIR2DL3 homozygote in the presence of HLA-C1C1 genotype shows protection against CHB. PMID: 20643584
  28. Results suggest a protective role of KIR2DL1/C2 in T1D. PMID: 20580654
  29. Eleven new KIR2DL1 alleles were identified by DNA sequencing of the coding region from amplified genomic DNA from 100 random African Americans PMID: 20210923
  30. The KIR2DL1 gene polymorphism and KIR/HLA-C gene compatibility are associated with type 1 diabetes. PMID: 20356536
  31. Data show that KIR activation and HLA expression density are critical determinants for the efficacy of rituximab treatment. PMID: 20056126
  32. study suggests that the activating KIR2DS4 may serve as CML susceptive gene to trigger leukemia development, while KIR2DS3 is possibly a protect gene of ALL PMID: 19450876
  33. Contrary to CD158a and CD158b killer immunoglobulin-like receptors (KIRs), there is a significant positive correlation of NKG2D and CD161 expression with NK cytotoxicity. PMID: 19711124
  34. interrupts TCR signaling, preventing dynamic membrane reorganization in CTL/tumor cell interaction PMID: 12351398
  35. The engagement of the activating isoforms of killer Ig-like receptor (KIR)(CD158a or CD158b) by their natural ligands, represented by soluble HLA-I molecules, induced programmed cell death of natural killer cells PMID: 12393468
  36. Positive linkage disequilibrium was seen between KRI2DL1 and KIR2DL3. PMID: 12559621
  37. The unique property of KIR2DL1 to become phosphorylated in the absence of adhesion and actin cytoskeleton rearrangement explains how KIRs can efficiently block early activation signals during NK-target cell contacts. PMID: 12794140
  38. Increased binding to influenza virus-infected cells is observed in the killer cell Ig-like receptor 2 domain long tail 1, binding that is functional and possibly results from generation of complexes of class I MHC proteins after influenza virus infection. PMID: 12847262
  39. A significant decrease in NK cell CD158a expression was demonstrated in recurrent spontaneous abortion women PMID: 15209394
  40. KIR2DS1 and KIR2DL1 share sensitivity to peptide sequence alterations. These results fit a model in which activating and inhibitory receptors recognize the same sets of self-MHC class I molecules, differing only in their binding affinities. PMID: 16141329
  41. Posttranslational modifications such as phosphorylation of a presented KIR2DL peptide alters the ability of natural killer (NK) cells to recognize MHC class I molecule HLA-Cw4, and results in improved NK cell killing. PMID: 16709835
  42. This is a new killer immunoglobulin-like receptor allele. PMID: 16774543
  43. alleles 2DL1*00302 and *002 were frequently observed in addition to two other known alleles and four new alleles, 2DL1*00402, 2DL1*007, 2DL1*008, and 2DL1*009 in three families and 77 bone marrow transplant patients and donors PMID: 17493149
  44. Data show that there was no correlation between CD15ab expression and disease activity in rheumatoid arthritis. PMID: 17497034
  45. CD158a and CD158b display a coactivatory function, involving the c-Jun NH2-terminal protein kinase signaling pathway, when expressed on malignant CD4+ T cells from a patient with Sezary syndrome PMID: 17522341
  46. KIR2DL1 may induce 2 opposite signaling outputs in CD4(+) T cells, depending on whether the KIR receptor is bound to its ligand. PMID: 18574028
  47. The role of this investigation has been to create a base of genetic information in relation to both KIR2DL1 and KIR2DS1 allele diversity. PMID: 18643963
  48. Findings provide novel insights into the molecular determinant of KIR2DL1 and conceivably a fundamental understanding of KIR2DL1 allelic polymorphism in human disease susceptibility, transplant outcome, and donor selection. PMID: 19828694

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Tissue Specificity
Expressed by NK cells.
Database Links

HGNC: 6329

OMIM: 604936

KEGG: hsa:3802

STRING: 9606.ENSP00000336769

UniGene: Hs.654605

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1