Recombinant Human Killer cell immunoglobulin-like receptor 2DL1(KIR2DL1)

Code CSB-CF012352HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43626
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
Source in vitro E.coli expression system
Gene Names KIR2DL1
Protein Names Recommended name: Killer cell immunoglobulin-like receptor 2DL1 Alternative name(s): CD158 antigen-like family member A MHC class I NK cell receptor Natural killer-associated transcript 1 Short name= NKAT-1 p58 natural killer cell receptor cl
Expression Region 22-348
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Tissue Specificity Expressed by NK cells.
Database Links

HGNC: 6329

OMIM: 604936

KEGG: hsa:3802

STRING: 9606.ENSP00000336769

UniGene: Hs.654605

Pathway Cellular senescence
Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR2DL1 Antibodies

KIR2DL1 Antibodies for Homo sapiens (Human)

KIR2DL1 Antibodies for Human

KIR2DL1 Proteins

KIR2DL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.