Recombinant Human Kunitz-type protease inhibitor 2 (SPINT2)

Code CSB-CF022585HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SPINT2
Uniprot No.
Alternative Names
SPINT2; HAI2; KOP; Kunitz-type protease inhibitor 2; Hepatocyte growth factor activator inhibitor type 2; HAI-2; Placental bikunin
Species
Homo sapiens (Human)
Expression Region
28-252
Target Protein Sequence
ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTYVL
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitor of HGF activator. Also inhibits plasmin, plasma and tissue kallikrein, and factor XIa.
Gene References into Functions
  1. The expression of SPINT2 gene is regulated by its methylation status, and the methylation status of SPINT2 is altered by HPV infection. The aberrant methylation status of SPINT2 gene may play an important role in the development of cervical cancer. PMID: 29843210
  2. aberrant methylation of the SPINT2 gene is frequently observed in high-grade gliomas and might confer MET signaling in the glioma cells. PMID: 29987920
  3. finding of only one heterozygous SPINT2 mutation in 19 patients with isolated CA/GA was not statistically significant PMID: 29499739
  4. In this work, KLK14 binding to either hepatocyte growth factor activator inhibitor type-1 (HAI-1) or type-2 (HAI-2) was essayed using homology modeling, molecular dynamic simulations and free-energy calculations through MM/PBSA and MM/GBSA. KLK14 was successfully modeled. PMID: 28817220
  5. limited role for HAI-2 in the inhibition of matriptase and prostasin is the result of its primarily intracellular localization in basal and spinous layer keratinocytes, which probably prevents the Kunitz inhibitor from interacting with active prostasin or matriptase PMID: 29438412
  6. that the HAI-2 Kunitz domain 1 mutants influence the flux of matriptase to the plasma membrane by affecting the oligomerization, maturation and/or folding of matriptase PMID: 28371047
  7. Our data indicate that hypoxic inhibition of JMJD3 activity reduces demethylation of H3K27me3, nucleosome removal, and hence induction of the STAT6 target gene CCL18, while induction of other STAT6-inducible genes such as SPINT2 remained unaffected by JMJD3. PMID: 27737800
  8. Concomitant presence of TMPRSS13 with HAI-2 mediates phosphorylation of residues in the intracellular domain of the protease, and it coincides with efficient transport of the protease to the cell surface and its subsequent shedding. PMID: 28710277
  9. This study presented a molecular characterization of congenital tufting enteropathy Italian patients, and identified one mutation in the SPINT2 gene PMID: 26684320
  10. study the methylation status of the promoter region of Serine peptidase inhibitor/hepatocyte growth factor activator inhibitor type 2 (SPINT2/HAI-2) PMID: 26030814
  11. It suggests an involvement of SPINT2 in PCa tumorigenesis, probably in association with a post-translational regulation of SPINT2. PMID: 26442953
  12. N-glycan branching regulates HAI-2 through different subcellular distribution and subsequently access to different target proteases PMID: 26171609
  13. Matriptase inhibition by HAI-2 requires the translocation of HAI-2 to the cell surface, a process which is observed in some breast cancer cells but not in mammary epithelial cells. PMID: 25786220
  14. Epigenetic silencing of SPINT2 promotes cancer cell motility in malignant melanoma. PMID: 25910030
  15. a missense mutation in the serine protease inhibitor SPINT2 may have a role in congenital sodium diarrhea PMID: 24722141
  16. results suggest that the SPINT2 underexpression in the MSC from MDS patients is probably involved in the adhesion of progenitors to the bone marrow niche, through an increased HGF and SDF-1 signaling pathway. PMID: 24410667
  17. The role of hepatocyte growth factor activator inhibitor-2 (HAI-2) in prostate cancer cell migration, invasion, tumorigenicity and metastasis. PMID: 24121274
  18. The tumor suppressor gene SPINT2 is commonly silenced by promoter hypermethylation in human esophageal squamous cell carcinoma and SPINT2 hypermethylation is correlated with poor overall survival. PMID: 24269829
  19. established SPINT2 as a second gene associated with congenital tufting enteropathy PMID: 24142340
  20. HAI-2 is an inhibitor of matriptase-2 that modulates the synthesis of hepcidin. PMID: 23293962
  21. HAI-1 and -2 are overexpressed in the liver in cholangiopathies with ductular reactions and are possibly involved in liver fibrosis and hepatic differentiation. PMID: 21898507
  22. Low HAI-2 is associated with endometrial cancer. PMID: 20715109
  23. HAI-2 protein is significantly decreased in malignant prostate cancer lesions as compared to normal and benign prostate hyperplasia lesions, and that the most poorly differentiated tumors have the lowest level of HAI-2 expression. PMID: 20687215
  24. Epigenetic inactivation of HAI-2/SPINT2 contributes to gastric carcinogenesis and may be a potential biomarker for gastric cancer. PMID: 20063316
  25. syndromic tufting enteropathy may be related to a SPINT2 mutation seen in congenital sodium diarrhea [case report] PMID: 20009592
  26. bik-R can physically interact with the CD44v isoforms containing epitope v9 and function as a repressor to down-regulate PMA-stimulated uPA expression, at least in part, by preventing clustering of CD44v isoforms containing epitope v9. PMID: 11777908
  27. Bikunin downregulates constitutive & PMA-stimulated uPAR mRNA & protein Through suppression of upstream ERK cascade targets, whether cells were treated with exogenous bikunin or transfected with bikunin gene. PMID: 12180971
  28. Urinary levels provide insight into proteinase/proteinase inhibitor imbalance in patients with inflammatory diseases. PMID: 12211652
  29. Bikunin was colocalized with tryptase in dermal mast cells, and a small quantity of bikunin was also deposited in the intercellular spaces in FE and ADL. PMID: 12522575
  30. there is a distinct regulation of hepatocyte growth factor activator inhibitor type 2 gene expression in testis and that HAI-2 may play a role in the process of spermatogenesis PMID: 12553733
  31. overexpression of bikunin is associated with suppression of invasion and peritoneal carcinomatosis of ovarian cancer cell line PMID: 12569552
  32. cDNA microarray analysis of gene expression regulated by bikunin in an ovarian cell line, including the pattern of gene expression leading to a block in cell invasion. PMID: 12571229
  33. Study demonstrates that the expression of HAI-2/PB is under methylation control to a variable extent in glioma cell lines, in comparison to the other tested neoplasm cell lines (brain, breast, prostate, liver). PMID: 14558597
  34. Low level of HAI-2 is associated with breast cancer PMID: 14734471
  35. The use of high hydrostatic pressure (1000-3000 bar) for the refolding of bikunin aggregates was investigated. PMID: 15388859
  36. suppresses lipopolysaccharide-induced lethality through down-regulation of tumor necrosis factor- alpha and interleukin-1 beta in macrophages. PMID: 15717269
  37. Epigenetic inactivation of HAI-2/SPINT2 causes loss of RCC tumor suppressor activity and implicates abnormalities of the MET pathway in clear cell and papillary sporadic RCC. PMID: 15930277
  38. There are no significant differences in serum HAI-2 levels among prostate cancer subgroups according to clinical stage. PMID: 16353247
  39. hepatocyte growth factor activator inhibitor 2 is regulated by hypoxia in breast cancer PMID: 17255277
  40. HAI2 hypermethylation is associated with hepatocellular carcinoma PMID: 18358501
  41. Low HAI-2 expression in cervical cancer may be associated with a poor prognosis. PMID: 18689863
  42. Unlike HAI-1 and matriptase, HAI-2 expression is detected in non-epithelial cells of brain and lymph nodes, suggesting that HAI-2 may also be involved in inhibition of serine proteases other than matriptase PMID: 18713750
  43. data support the role of SPINT2 as a putative tumor suppressor gene in medulloblastoma and further implicate dysregulation of the HGF/MET signaling pathway in the pathogenesis of medulloblastoma PMID: 19047176
  44. HAI-2 is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function PMID: 19107935
  45. HAI-1 and HAI-2 may possibly be therapeutic target for treatment approaches in ovarian cancer. PMID: 19148468
  46. Syndromic congenital sodium diarrhea is a distinct diseas entity cause by SPINT2 loss-of-function mutations. PMID: 19185281
  47. The active form of HGFA is specifically complexed with the membrane-form HAI-1 (serine peptidase inhibitor, Kunitz type 1), but not with HAI-2/PB (serine peptidase inhibitor, Kunitz type 2), on the surface of epithelial cells expressing both inhibitors. PMID: 11013244
  48. Frequent hypermethylation of SPINT2 gene in human hepatocellular carcinoma PMID: 14695180

Show More

Hide All

Involvement in disease
Diarrhea 3, secretory sodium, congenital, with or without other congenital anomalies (DIAR3)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in placenta, kidney, pancreas, prostate, testis, thymus, and trachea.
Database Links

HGNC: 11247

OMIM: 270420

KEGG: hsa:10653

STRING: 9606.ENSP00000301244

UniGene: Hs.31439

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1