Recombinant Human L-selectin (SELL)

Code CSB-CF020977HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
SELL; LNHR; LYAM1; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte surface antigen Leu-8; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; TQ1; gp90-MEL; CD antigen CD62L
Species
Homo sapiens (Human)
Expression Region
39-372
Target Protein Sequence
WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
Gene References into Functions
  1. L-selectin (CD62L) has been identified as an HIV-1 adhesion receptor on CD4+ T cells. PMID: 30026537
  2. PI3K is a signal linker between L-selectin and PSGL-1 in IL-18 transcriptional activation at the promoter level. PMID: 29218606
  3. SELL expression was not altered in systemic sclerosis. PMID: 29356883
  4. Dual regulation of CD62L by HIV-1 via enhanced expression by Vpr in contrast with cell-surface down-modulation by Nef and Vpu has been reported. PMID: 30119013
  5. Recombinant human IL33 inhibited trophoblast invasion and adhesion, and decreased adhesion and invasionassociated molecules such as integrin alpha4beta1 and CD62L. PMID: 28765940
  6. CD62L has merit for risk stratification in natalizumab treatment is associated with progressive multifocal leukoencephalopathy. PMID: 26432858
  7. sLe(x) expressed on human L-selectin is preferentially bound by E-selectin and, on ligation, initiates secretion of MRP8/14 that binds TLR4 to elicit the extension of beta2-integrin to an intermediate affinity state. PMID: 28811304
  8. Here, we further developed and applied this method to express and purify the entire extracellular region of CD62L. This resulted in excess of 20 mg/L yield of recombinant CD62L. In an attempt to understand the different expression levels among four similar CD62L constructs that differ primarily in signal sequences, we calculated the presence of potential RNA pseudoknots in their signal sequences PMID: 28842197
  9. identified CD62L as a marker of a distinct NKT subset endowed with high proliferative potential and have developed artificial antigen-presenting cells that generate CD62L-enriched NKTs for effective cancer immunotherapy PMID: 27183388
  10. The -642C>T and 725C>T SELL polymorphisms are protective factors against acute coronary syndrome. SELL gene expression was increased in ACS patients. PMID: 28478085
  11. CD62L downregulation due to unconstrained HIV-1 replication may have important consequences for T-cell circulation and function and for HIV-1 disease progression PMID: 27003497
  12. found a higher frequency of LIN1(-) CCR3(+) eosinophils, and decreased expression of CD23 and CD62L receptors in eosinophils of AD patients PMID: 27406841
  13. Indian patients with primary Sjogren's syndrome have higher salivary sL-selectin and IL-7 levels than healthy controls PMID: 27620619
  14. While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected PMID: 26361072
  15. These data confirm the expression of CD62L on urothelial carcinoma cells and suggest that CD62L may serve as biomarker to predict the presence of or risk for developing metastatic disease in patients with bladder cancer. PMID: 25618296
  16. freeze and thaw of murine and human Tregs is associated with reduced expression of L-selectin (CD62L), which was previously established to be an important factor that contributes to the in vivo protective effects of Tregs PMID: 26693907
  17. Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria PMID: 26852488
  18. Here we report that HIV-1 down-modulates CD62L in productively infected naive and memory resting CD4 T cells while suppressing Foxo1 activity and the expression of KLF2 mRNA. PMID: 25330112
  19. the polymorphisms within L-selectins gene were not associated with Visceral leishmaniasis and it may be concluded that these genotypes and alleles are unable to affect immune responses in Visceral leishmaniasis patients PMID: 25209910
  20. Functional analyses revealed that the lymphocyte homing receptor L-selectin (CD62L) is the key factor controlling the binding of chronic lymphocytic leukemia cells to high endothelial venule walls in vivo. PMID: 26162407
  21. SELL rs7531806 and rs1060573 are involved in androgen metabolism, inflammation processes and scar formation in severe acne. PMID: 24399259
  22. Both Nef and Vpu associated with and sequestered CD62L in perinuclear compartments, thereby impeding CD62L transport to the plasma membrane. PMID: 25822027
  23. Variants within the SELL gene are associated with sL-selectin levels. Despite accounting for a significant portion of the protein level variance, none of the variants was associated with clinical or subclinical cardiovascular disease. PMID: 25576479
  24. P-selectin glycoprotein ligand-1 and L-selectin have roles in neutrophil recruitment and activate human endothelial colony-forming cells at the site of vessel injury PMID: 24606340
  25. Increased expression of L-selectin ligands may be involved in the implantation process in tubal pregnancy. PMID: 24829027
  26. A cellular model system for quantifying L-selectin adhesion mechanics, is described. PMID: 23927766
  27. Individuals who undertake physical activity regularly, benefit from each single physical effort, because of decrease in serum concentration of proinflammatory molecules such as L-selectin and P-selectin. PMID: 25095634
  28. in a large, multiethnic population, soluble L-selectin levels did not predict clinical or subclinical cardiovascular disease PMID: 24631064
  29. results indicate a regulatory influence of MR signaling on human T-cell migration and suggest a role for endogenous aldosterone in the redistribution of T-cell subsets to lymph nodes, involving CD62L, CCR7, and CXCR4. PMID: 24595810
  30. the association between expression of the adhesion molecule CD62L (L-selectin) on naive and central memory T cells and the formation of antigen-specific antibodies differed significantly between younger and elder donors. PMID: 23571167
  31. The PSGL-1-L-selectin complex-induced signaling effects on neutrophil slow rolling and recruitment in vivo demonstrate the functional importance of this pathway. PMID: 24127491
  32. Molecular basis for the moesin/l-selectin/CaM ternary complex; an important role for phospholipids in modulating l-selectin function and shedding. PMID: 23796515
  33. the association of calmodulin with L-selectin PMID: 23658780
  34. Cell-based assessment of the percentage of L-selectin-expressing CD4 T cells could provide an urgently needed biomarker for individual risk assessment of progressive multifocal leukoencephalopathy (PML). PMID: 23925765
  35. Coronary artery disease patients blood samples showed a significantly higher L-selectin, but not CD11b response to TLR stimulation than controls. PMID: 23573259
  36. Over-activation of ADAM17 in NK cells may be detrimental to their effector functions by down-regulating surface expression of CD16 and CD62L. PMID: 23487023
  37. ATP induces CD62L downregulation from the surface of naive CD4+ T lymphocytes through the P2X7 receptor. PMID: 23319734
  38. association between L-selectin concentrations in plasma and skin damage in patients with systemic sclerosis PMID: 23028631
  39. Native glycodelin-A binds to peripheral blood monocytes inducing interleukin-6 secretion through L-selectin. PMID: 22977256
  40. determination of critical patch lengths of P-and L-selectin for the initiation of HL-60 cell binding in shear flow PMID: 22627390
  41. a unique lymphoid-primed population in human bone marrow was generated from hematopoietic stem cells before onset of expression of CD10 and commitment to the B cell lineage identified by high expression of the homing molecule L-selectin (CD62L). PMID: 22941246
  42. [review] Distinct domains of L-selectin contribute to proper leukocyte migration out of the vasculature into surrounding tissues during inflammation and immune surveillance. PMID: 21546114
  43. P213S polymorphism of the L-selectin gene is associated with type 2 diabetes and insulin resistance. PMID: 22921892
  44. Pretreatment of cardiac mesoangioblasts with SDF-1 or transient expression of L-selectin induced a two- to three-fold increase in their transmigration and homing to the damaged heart. PMID: 21869829
  45. No statistically significant results were found in order to sustain the hypothesis of association between SELL gene P213S polymorphism, type 2 diabetes mellitus and end stage renal disease. PMID: 22119815
  46. Levels of P-selectin and L-selectin were decreased in AD and lowest in AD patients with highest cognitive decline. Our findings suggest that these molecules may induce alterations of endothelial regulation and influence neurodegenerative processes of AD PMID: 21484243
  47. Lower frequency of CD62L(high) and higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients. PMID: 21584225
  48. L-selectin gene may play a role in the development of ischemic stroke. PMID: 21465128
  49. These results suggest that the association of CaM with L-selectin in the cell can be influenced by the membrane bilayer and that anionic lipids may modulate ectodomain shedding of transmembrane receptors. PMID: 21664913
  50. Data show that L-selectin TM and cytoplasmic domains lack the ability to dimerize in cell membranes. PMID: 21316337

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Selectin/LECAM family
Tissue Specificity
Expressed in B-cell lines and T-lymphocytes.
Database Links

HGNC: 10720

OMIM: 153240

KEGG: hsa:6402

STRING: 9606.ENSP00000236147

UniGene: Hs.728756

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1