Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 3(LILRB3)

Code CSB-CF012941HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O75022
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH
Source in vitro E.coli expression system
Gene Names LILRB3
Protein Names Recommended name: Leukocyte immunoglobulin-like receptor subfamily B member 3 Short name= LIR-3 Short name= Leukocyte immunoglobulin-like receptor 3 Alternative name(s): CD85 antigen-like family member A Immunoglobulin-like transcript 5 Shor
Expression Region 24-631
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Detected in monocytes and B-cells.
Database Links

HGNC: 6607

OMIM: 604820

KEGG: hsa:102725035

STRING: 9606.ENSP00000245620

UniGene: Hs.631592

Related Products

LILRB3 Antibodies

LILRB3 Antibodies for Homo sapiens (Human)

LILRB3 Antibodies for Human

LILRB3 Proteins

LILRB3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.