Recombinant Human Leukotriene B4 receptor 2 (LTB4R2)

Code CSB-CF013222HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
LTB4R2
Uniprot No.
Alternative Names
LTB4R2; BLT2R; BLTR2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; LTB4 receptor JULF2; Leukotriene B4 receptor BLT2; Seven transmembrane receptor BLTR2
Species
Homo sapiens (Human)
Expression Region
1-389
Target Protein Sequence
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Low-affinity receptor for leukotrienes including leukotriene B4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via G-proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTB4 > 12-epi-LTB4 > LTB5 > LTB3.
Gene References into Functions
  1. In a group of 545 breast cancer patients with metastasis, authors observed that the high-BLT2 subgroup had a lower disease-free-survival rate than the low-BLT2 subgroup. PMID: 29898809
  2. BLT2 gene polymorphism (D196G) enhances ligand sensitivity, thereby increasing cell motility in response to low-dose ligand stimulation. PMID: 29170475
  3. Leukotriene B4 receptor type 2 protects against pneumolysin-dependent acute lung injury. PMID: 27703200
  4. BLT2 ligation facilitates F-actin assembly with the upregulated phosphorylation of MYPT1. PMID: 26896822
  5. Supernatants and lipids from stored red blood cells activate pulmonary microvascular endothelium through the BLT2 receptor PMID: 28880373
  6. RanBPM acts as a negative regulator of BLT2 and IL8, thus attenuating the invasiveness of aggressive breast cancer cells PMID: 28027932
  7. BLT2 inhibition induces apoptosis, inhibits proliferation, colony formation and self-renewal capacity of CD34(+) cells from tyrosine kinase inhibitor - resistant blast phase-chronic myeloid leukemia patients. PMID: 26966074
  8. Data show that signal transducer and activator of transcription-3 (STAT-3) activation occurs downstream of leukotriene B4 receptor-2 (BLT2) and mediates cisplatin resistance in SK-OV-3 cells. PMID: 26597704
  9. Authors demonstrated that MyD88 lies upstream of BLT2 in LPS-potentiated invasiveness and that this 'MyD88-BLT2' cascade mediates activation of NF-kappaB and the synthesis of IL-6 and IL-8 critical for the invasiveness and aggression of breast cancer cells. PMID: 25691060
  10. BLT1 and BLT2 are therefore potential targets for the development of novel drugs. PMID: 25480980
  11. searched BLT2 downstream components and identified reactive oxygen species and nuclear factor kappaB as critical components that contribute to epithelial-mesenchymal transition in mammary epithelial cells PMID: 24990945
  12. BLT2-NOX-ROS-NF-kappaB cascade induction during detachment confers a novel mechanism of anoikis resistance in prostate cancer cells and potentially contributes to prostate cancer progression. PMID: 23986446
  13. RanBPM acts as a negative regulator of BLT2 signaling to attenuate BLT2-mediated cell motility PMID: 23928309
  14. Findings indicate that BLT2 has a protective role in allergic airway inflammation and that diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma. PMID: 23603839
  15. BLT2 is a novel therapeutic target that sensitises drug-resistant breast cancer cells to paclitaxel. PMID: 23799854
  16. Findings suggest that, in bronchial epithelial cells, cigarette smoke extracts (CSE) promote induction of pro-inflammatory BLT2 receptors and activate mechanisms leading to increased neutrophil adhesion. PMID: 23347335
  17. our study demonstrates that a BLT2 up-regulates IL-8 production , thereby contributing to the invasiveness of these aggressive breast cancer cells. PMID: 23145117
  18. LTB4R2 shows splice variation in the 5'-untranslated region and multiple promoter regions. LTB4R2 polymorphisms do not appear to be susceptibility markers for the development of asthma in Caucasian subjects. PMID: 23167751
  19. The results suggested that LTB4 receptors BLT1 and BLT2 are involved in IL-8 production in and secretion by human neutrophils induced by T. vaginalis. PMID: 22215047
  20. Leukotriene B4 receptor-2 promotes invasiveness and metastasis of ovarian cancer cells through signal transducer and activator of transcription 3 (STAT3)-dependent up-regulation of matrix metalloproteinase 2 PMID: 22396544
  21. these findings point to BLT2 as a key regulator of AR expression and will contribute to the development of novel therapies for AR-positive prostate cancers, including androgen-responsive and castration-resistant prostate cancers. PMID: 22426480
  22. BLT2 phosphorylation at Thr355 by Akt is necessary for BLT2-mediated chemotaxis PMID: 22044535
  23. Up-regulation of BLT2 is associated with bladder cancer. PMID: 21252614
  24. BLT2-Nox1-reactive oxygen species-dependent pathway plays a role in promoting the secretion of IL-8 from human mast cells in response to the proinflammatory cytokine IL-1beta, thus contributing to angiogenesis. PMID: 20194723
  25. a "BLT2-Nox1"-linked pathway has a crucial role in UVB-induced ROS generation and mediates apoptosis in human keratinocytes PMID: 20090768
  26. the 'BLT2-Nox1-ROS'-linked cascade is involved in the pro-survival signaling, especially in ER-negative breast cancer cells. PMID: 19748928
  27. BLT2 stimulates the purified G alpha(i2) beta(1) gamma(2) protein more efficiently than the dimer; assembly of two BLT2 protomers into a dimer results in the reduced ability to signal PMID: 20026606
  28. BLT2 plays a pivotal, mediatory role in the pathogenesis of asthma, acting through a "reactive oxygen species-NF-kappaB"-linked inflammatory signaling pathway. PMID: 19448154
  29. BLT2 is a low-affinity leucotriene B4 receptor; 358 amino acid sequence is 92.7% identical to the mouse receptor PMID: 12895595
  30. BLT2 (the low-affinity receptor for LTB4) showed stronger expression than BLT1 (the high-affinity receptor) in actively inflamed synovial tissue from patients with rheumatoid arthritis PMID: 12913925
  31. LTB4-BLT2-linked cascade plays a crucial mediatory role in the cell transformation induced by oncogenic Ha-Ras(V12), possibly acting downstream of Rac-cPLA2 PMID: 15489890
  32. Data indicate that expression of functional leukotriene B4 receptors (BLT1 and 2) may occur at the surface of endothelial cells in response to lipopolysaccharides, cytokines, and LTB4. PMID: 16624877
  33. demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expression PMID: 16920986
  34. BLT2-Nox1-linked cascade is responsible for the elevated ROS generation in Ras-transformed cells. PMID: 18082638
  35. Genetic variation in leukotriene pathway members and their receptors confer an increased risk of ischemic stroke in 2 independent populations PMID: 18323512
  36. BLT2 was expressed in 45% of ovarian neoplasms and correlated with advanced stage III/IV disease, suboptimal debulking, and platinum resistance. PMID: 18421027
  37. Upregulation of BLT2 is already evident in precursor lesions (PanINs, IPMNs). Overexpression of this receptor leads to significant growth stimulation PMID: 18781173
  38. LTB4 phosphorylates MAPKs and stimulates NF-kappaB-dependent inflammation via BLT1 and BLT2 receptors in cultured monocytic cells. The blockade of this pathway could be a novel and potential therapeutic target in atherothrombosis. PMID: 18852255
  39. the response of the pleural mesothelium to LTB4 is the result of a balance between the activation of receptors for LTB4 with a proinflammatory outcome (BLT2) and the activation of a different receptor for LTB4 with an anti-inflammatory outcome (PPAR). PMID: 18981151
  40. results suggest that the helix 8 region of hBLT2 plays an important role in transport-competent receptor folding. PMID: 19126593
  41. Findings indicate that BLT2 plays an essential role in mediating VEGF-induced angiogenesis. PMID: 19286633

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 19260

OMIM: 605773

KEGG: hsa:56413

STRING: 9606.ENSP00000433290

UniGene: Hs.642693

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1