Recombinant Human Lysosomal-associated transmembrane protein 4B (LAPTM4B)

Code CSB-CF774814HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
LAPTM4B
Uniprot No.
Alternative Names
LAPTM4B; PSEC0001; Lysosomal-associated transmembrane protein 4B; Lysosome-associated transmembrane protein 4-beta
Species
Homo sapiens (Human)
Expression Region
1-370
Target Protein Sequence
MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRV TWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRR GGLQARRSTLLKTCARARATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIIN AVVLLILLSALADPDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICAMATYGAYKQ RAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVL IILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATVNGAA KEPPPPYVSA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for optimal lysosomal function. Blocks EGF-stimulated EGFR intraluminal sorting and degradation. Conversely by binding with the phosphatidylinositol 4,5-bisphosphate, regulates its PIP5K1C interaction, inhibits HGS ubiquitination and relieves LAPTM4B inhibition of EGFR degradation. Recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, promoting entry of leucine and other essential amino acid (EAA) into the lysosome, stimulating activation of proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and hence mTORC1 activation. Plays a role as negative regulator of TGFB1 production in regulatory T cells. Binds ceramide and facilitates its exit from late endosome in order to control cell death pathways.
Gene References into Functions
  1. our results illustrate the LAPTM4B gene as a diagnostic biomarker in patients with hepatocellular carcinoma having documented evidence of chronic hepatitis C virus infection PMID: 29882487
  2. that LAPTM4B plays an important role in the promotion of hepatocarcinogenesis and cancer progression and may serve as a biomarker for the diagnosis and monitoring of hepatocellular carcinoma PMID: 29108920
  3. Findings suggest that lysosome-associated transmembrane protein 4B (LAPTM4B), vascular endothelial growth factor (VEGF), and nuclear survivin expression are significantly correlated in breast cancer, which may be predictive of prognosis as well as effective therapeutic targets for anticancer therapies. PMID: 28476037
  4. LAPTM4B-35 is a novel cancer-driving protein that can be inhibited by ethylglyoxal bisthiosemicarbazon PMID: 27542271
  5. The overexpressed LAPTM4B-35 was an independent prognostic biomarker for non-small-cell lung cancer, which could predict cancer recurrence and poor over survival. PMID: 27486880
  6. The findings of this study showed LAPTM4B-35 to be strongly associated with tumor proliferation, tumor angiogenesis and poor outcomes of GBM patients. PMID: 28097442
  7. Findings suggested that LAPTM4B allele *1 was a risk factor associated with poor prognosis in patients with colon cancer, but not in patients with rectal or esophageal cancers. LAPTM4B genotype status might be a useful prognostic indicator for patients that need surgical operation in colon cancer. PMID: 27391361
  8. These findings indicate that the LAPTM4B*2 allele is associated with the high risk of pancreatic carcinoma and carrying LAPTM4B*2 may be a susceptible factor to Chinese pancreatic carcinoma patients PMID: 28618967
  9. High expression level of LAPTM4B predicts tumor metastatic potential in patients with breast cancer. PMID: 28245476
  10. Cox analysis demonstrated that combined LAPTM4B-35 and VEGF expression was an independent factor for both OS and DFS (P = 0.015 and P = 0.016, respectively). Overexpression of LAPTM4B-35combined with positive VEGF expression may serve as a new biological marker to predict the prognosis of cervical carcinoma patients. PMID: 26526574
  11. Compared with the control cells, the LAPTM4B-miRNA-transfected NIH:OVCAR3 cells exhibited significant decreases in cell motility and invasion. Furthermore, LAPTM4B depletion resulted in a significant decrease in proliferating cell nuclear antigen, vascular endothelial growth factor, MMP2, MMP9, and CDK12 expression PMID: 26247403
  12. Findings provide evidence that LAPTM4B plays an important role in promoting tumor angiogenesis. PMID: 26383850
  13. Our study points to the relevance of LAPTM4B expression to NSCLC pathogenesis as well as to the probable role of LAPTM4B/NRF2 signaling in promoting lung cancer cell survival. PMID: 26343532
  14. LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to uptake of leucine into lysosomes. PMID: 25998567
  15. These findings indicate that LAPTM4B-35 overexpression may be related to GC progression and poor prognosis, and thus may serve as a new prediction marker of prognosis in GC patients. PMID: 25849595
  16. Authors found that restoration of miR-188-5p can inhibit the PI3K/AKT signaling pathway via the suppression of LAPTM4B. PMID: 25714029
  17. LAPTM4B-35 overexpression is associated with small cell lung cancer. PMID: 25910706
  18. LAPTM4B-35 over-expression was an independent factor in gastric carcinoma prognosis PMID: 25689860
  19. By compartmentalizing ceramide, LAPTM4B controls key sphingolipid-mediated cell death mechanisms and emerges as a candidate for sphingolipid-targeting cancer therapies. PMID: 26280656
  20. LAPTM4B binds to GARP and is a negative regulator of TGF-beta1 production in human Tregs PMID: 26126825
  21. no association between LAPTM4B polymorphism and the risk of breast cancer in a sample of Iranian population PMID: 25001088
  22. Overexpression of LAPTM4B protein is correlated with tumor angiogenesis and poor prognosis in non-small cell lung cancer. PMID: 24816841
  23. The results reveal an essential layer of EGFR trafficking regulated by LAPTM4B, PtdIns(4,5)P2 signaling, and the ESCRT complex and define a mechanism by which the oncoprotein LAPTM4B can transform cells and promote tumor progression. PMID: 25588945
  24. LAPTM4B-35 is consistently expressed in gastric cancer and is associated with specific clinicopathological and immunohistochemical characteristics. PMID: 25416438
  25. The results suggest that LAPTM4B polymorphisms may be a prospective marker for evaluating the risk and prognosis of non-small cell lung cancer. PMID: 24676601
  26. Overexpression of LAPTM4B-35 may be associated with tumor progression and poor prognosis in prostate cancer. PMID: 24651764
  27. The LAPTM4B *2 allele was associated with increasing risk of multiple cancers, tumor initiation and development in Chinese populations. [meta-analysis] PMID: 24746178
  28. LAPTM4B, with increased expression in airways at shorter distance from tumors, was upregulated in human immortalized cells compared with normal bronchial epithelial cells and promoted anchorage-dependent and independent lung cancer cell growth. PMID: 24563515
  29. LAPTM4B was found to not exhibit any expression changes between different classes of pituitary adenomas. PMID: 23023342
  30. SNPs in lysosomal-associated transmembrane protein 4 beta (LAPTM4B) and insulin-like growth factor 1 (IGF1) were associated with both susceptibility to and curve severity in adolescent idiopathic scoliosis in Korea. PMID: 23364988
  31. study identified the core promoter region responsible for constitutive expression of LAPTM4B and clarified that CREB1 played an important role in LAPTM4B transcriptional regulation in human breast cancer cells PMID: 23469012
  32. LAPTM4B allele *2 may be a risk factor associated with genetic susceptibility to GBC. PMID: 22302286
  33. Endometrial carcinoma patients with LAPTM4B *2 variant had both significantly shorter overall survival and disease-free survival. PMID: 23312008
  34. The results of our study indicated that the polymorphism of LAPTM4B gene did not influence the susceptibility of nasopharyngeal carcinoma in the Chinese population PMID: 23345117
  35. allele *2 of LAPTM4B appears to be associated with genetic susceptibility of HCC and may therefore be considered as a risk factor. PMID: 22207410
  36. High LAPTM4B expression is associated with lymph node metastasis, and recurrence in breast cancer. PMID: 23292099
  37. LAPTM4B*2 is a risk factor associated with breast cancer susceptibility and poor prognosis PMID: 22984585
  38. Data suggest that lysosomal protein transmembrane 4 beta (LAPTM4B) status may be useful in preoperative evaluation of the operability of gallbladder carcinoma (GBC). PMID: 22984631
  39. LAPTM4B-35 was found to be present at high levels in a large proportion of patients with pancreatic carcinoma, and was closely related to disease progression and poor prognosis. PMID: 22971479
  40. LAPTM4B overexpression is an independent factor in poor colorectal cancer prognosis, and it may be an important potential biomarker. PMID: 22578410
  41. LAPTM4B allelic variation was significantly associated with breast cancer occurrence, with adjusted odds ratios of 1.387 (95%CI = 1.111-1.730) for LAPTM4B*1/2 and 1.592 (95% CI = 1.043-2.430) for LAPTM4B*2/2 genotype. PMID: 22270081
  42. gene polymorphism of LAPTM4B may influence the individuals' susceptibility to primary liver cancer. PMID: 22156622
  43. LAPTM4B expression was found to have a significant inverse correlation on prognosis in patients with metastatic ovarian tumors and may be an independent prognostic marker for metastatic ovarian tumors. PMID: 22193644
  44. LAPTM4B is a risk factor associated with poor prognosis in patients with resected HCC. LAPTM4B status may be useful preoperatively as an adjunct in evaluation of the operability of HCC. PMID: 22509374
  45. Findings indicate that the LAPTM4B 2 allele may be a risk factor for ovarian cancer and may play an important role in genetic susceptibility to ovarian cancer. PMID: 22412199
  46. Data show that LAPTM4B protein was localized in lysosomes where its depletion increased membrane permeability, pH, cathepsin release, and cellular apoptosis. PMID: 22037872
  47. Upregulation of LAPTM4B-35 promotes malignant transformation and liver tumorigenesis. PMID: 21618708
  48. overexpression of LAPTM4B-35 attenuated epirubicin-induced apoptosis of gallbladder carcinoma GBC-SD cells through a mitochondria-dependent pathway PMID: 21429547
  49. the LAPTM4B*2 allele might be a cervical cancer risk factor and may play an important role in genetic susceptibility to cervical cancer in the Chinese population. PMID: 21656743
  50. Over-expression of LAPTM4B is associated with chemotherapy resistance and stages III and IV epithelial ovarian cancer PMID: 21416470

Show More

Hide All

Subcellular Location
Endomembrane system; Multi-pass membrane protein. Late endosome membrane. Cell membrane. Cell projection. Lysosome membrane. Endosome membrane. Endosome, multivesicular body membrane. Endosome, multivesicular body lumen.
Protein Families
LAPTM4/LAPTM5 transporter family
Database Links

HGNC: 13646

OMIM: 613296

KEGG: hsa:55353

STRING: 9606.ENSP00000402301

UniGene: Hs.492314

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1