Recombinant Human Melanocortin receptor 3 (MC3R)

Code CSB-CF013560HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MC3R
Uniprot No.
Alternative Names
MC3R; Melanocortin receptor 3; MC3-R
Species
Homo sapiens (Human)
Expression Region
1-360
Target Protein Sequence
MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQA PFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVA DMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRY VTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLM GTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLV LIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain.
Gene References into Functions
  1. This article reviews the MC3R polymorphisms and mutations identified in humans, and the in vitro, murine, and human cohort studies examining their putative effects. Certain human MC3R mutations are associated with greater adiposity and hyperleptinemia. [review] PMID: 28363697
  2. Structural Insights into Selective Ligand-Receptor Interactions Leading to Receptor Inactivation Utilizing Selective Melanocortin 3 Receptor Antagonists. PMID: 28715181
  3. MC3R mutations are associated with Obesity. PMID: 27288827
  4. findings support the role of MC3R genetic variants in adiposity gain during early childhood. PMID: 26663875
  5. There is no evidence of any association between MC3R variations and obesity. PMID: 26782456
  6. Replacing murine Mc3r with and double-mutant (C17A+G241A) human MC3R showed greater weight and fat mass, increased energy intake and feeding efficiency. PMID: 26818770
  7. the DPLIY motif and helix 8 was important for MC3R activation and signal transduction. The data led to a better understanding of the structure-function relationship of MC3R. PMID: 26220347
  8. novel data about the structure-function relationship of MC3R, identifying residues important for receptor function; some studied mutations exhibited biased signaling, preferentially activating one intracellular signaling pathway. PMID: 25798062
  9. propose three potential human candidate genes for voluntary physical exercise levels (MC3R, CYP24A1, and GRM8). PMID: 24821406
  10. The cytoplasmic end of transmembrane domain 3 and the intracellular loop 2 were critical for MC3R function. PMID: 25228159
  11. MC3R polymorphism is marginally associated in the development of pulmonary tuberculosis in Korean population. PMID: 25064630
  12. MC3R is a 2-exon gene that requires a 5' UTR for translation, localization, and potential interaction with MRAP2 PMID: 25051171
  13. 3' RACE experiments using MC3R transcript indicated the 3' UTR terminates approximately 115-160 bases after the translational stop codon. PMID: 25450386
  14. This study focused on the search for the MC3R polymorphism in the Polish population. PMID: 24142065
  15. Overall, the total prevalence of rare MC3R variants was 1 % in Belgian obese children and adolescents compared to 1.02 % in lean controls. PMID: 23264184
  16. Suggest MC3R rs6127698 polymorphism is associated with pulmonary tuberculosis in a sample Iranian population. PMID: 23827504
  17. Data suggest that specific amino acid residues (M247, R252, H254, K256, R257, A259) in 3rd intracellular loop (ICL3) of MC3R are important for ligand binding/signal transduction; studies used mutant, recombinant MC3R expressed in HEK293T cell line. PMID: 23323615
  18. while MC3R mutations are unlikely to result in an autosomal dominant form of monogenic obesity given lack of strong cosegregation in family studies, the studies provided evidence that MC3R can be one of the genes which contributes to increased adiposity [review] PMID: 23280863
  19. results suggest MC3R rs6127698 has no direct role in tuberculosis susceptibility. The possibility remains that this polymorphism is linked to an adjacent functional genetic variant, acting as a surrogate marker for disease risk PMID: 23497691
  20. we provided detailed data of these novel human MC3R mutations leading to a better understanding of structure-function relationship of MC3R and the role of MC3R mutation in obesity PMID: 22884546
  21. Interaction of the melanocortin 3 receptor (MC3R) and the growth hormone secretagogue receptor (GHSR)-1a results in a modulation of function in both receptors. PMID: 22327910
  22. The polymorphism T6K is not located in the coding region of the human MC3R and has no influence on translation initiation which makes an impact on body weight unlikely. PMID: 22433616
  23. Carriers of the MC3R 6Lys-81Ile haplotype showed higher respiratory quotient and higher glucose oxidation compared with non-carriers after standardization for fat-free mass. PMID: 21983807
  24. Extracellular cysteine residue C305, C311 and C313 are crucial for receptor expression and the transmembrane cysteine residue, C115 and 162 are important for ligand binding and signaling. PMID: 22079958
  25. in the populations studied functionally significant MC3R variants are associated with obesity PMID: 21047972
  26. The study provided overall sufficient evidence to support that there is no major effect of genetic variants of MC3R and differential weight loss. PMID: 21695122
  27. We demonstrated that the MC3R polymorphisms have a protective effect on metabolic traits. PMID: 21920079
  28. Polymorphisms in MC3R promoter and CTSZ 3'UTR are associated with tuberculosis susceptibility. PMID: 21368909
  29. A role of the MC3R gene in the pathogenesis of obesity in a small subset of patients. PMID: 20539302
  30. While MC3R is an important regulator of energy homeostasis, mutations in the MC3R gene remain controversially associated with human obesity pathogenesis.[Review] PMID: 20882712
  31. data are consistent with the involvement of rs3746619 in weight regulation among obese individuals PMID: 20972733
  32. There is not sufficient evidence to support the contribution for common melanocortin-3 receptor variants in childhood obesity. However, our results are concordant for a role of melanocortin-3 receptor variants in some dimensions of eating behavior. PMID: 20144537
  33. A novel melanocortin 3 receptor gene (MC3R) mutation associated with severe obesity. PMID: 11889220
  34. An association between an insertion polymorphism was observed with fat mass, percent body fat, and total abdominal fat. PMID: 12142547
  35. variaton in a Maori kindred with obesity and early onset type 2 diabetes PMID: 12161058
  36. functional characterization of the I183N mutated MC3R compared with that of the wild-type MC3R after transfection in HEK293 cells PMID: 15276649
  37. MC3R mutation might be genetic factor that confers susceptibility to obesity, likely due to haploinsufficiency. We identify a residue that is critical for activation of G protein-coupled receptors. PMID: 15292330
  38. Single-nucleotide polymorphisms found in anorexia nervosa. PMID: 16314751
  39. Our results suggest that TM3 and TM6 are important for NDP-MSH binding, while D121 in TM2 and D332 in TM7 are crucial for receptor activity and signaling.and thus provide molecular determinants of hMC3R responsible for ligand binding and receptor signals PMID: 16430209
  40. in addition to its inverse agonistic activities, Agrp exhibits agonistic properties on the endocytosis pathway of melanocortin-3 and -4 receptors PMID: 17041250
  41. SNPs of MC3R may regulate substrate oxidation and first-phase insulin secretion. PMID: 17192297
  42. results suggest a gene-diet interaction between the MC3R C17A and G241A variants and a weight loss program for the ability to lose weight in childhood obesity PMID: 17413091
  43. Further structure-activity studies of lactam derivatives of MT-II and SHU-9119 were made at MC3R. PMID: 17482720
  44. MC3R mutations may not result in autosomal dominant forms of obesity but may contribute as a predisposing factor to childhood obesity. PMID: 17639020
  45. highly conserved N/DPxxY motif, was critical for multiple aspects of the MC3R function, including cell surface expression, ligand binding, and signaling. PMID: 17964765
  46. In the Maori kindred, the D20S32e polymorphism is significantly associated with insulin resistance but not with the metabolic syndrome. PMID: 18180070
  47. in humans, MC3R mutations may be a cause of a dominantly inherited form of obesity PMID: 18231126
  48. there is a link between MC3R and cell growth pathways that may involve the alteration of AKT signaling pathway PMID: 18291523
  49. unlikely that MC3R gene plays a major role in tuberculosis susceptibility in African populations PMID: 18420963
  50. acidic residues in transmembrane (TM) domains 1 and 3 are important for ligand binding whereas the acidic residues in TMs 2 and 7 are important for both ligand binding and signaling PMID: 18614155

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Brain, placental, and gut tissues.
Database Links

HGNC: 6931

OMIM: 155540

KEGG: hsa:4159

STRING: 9606.ENSP00000243911

UniGene: Hs.248018

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1