Recombinant Human Melanocortin receptor 5(MC5R)

Code CSB-CF013562HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P33032
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ EMRKTFKEIICCRGFRIACSFPRRD
Source in vitro E.coli expression system
Gene Names MC5R
Protein Names Recommended name: Melanocortin receptor 5 Short name= MC5-R Alternative name(s): MC-2
Expression Region 1-325
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. This receptor is a possible mediator of the immunomodulation properties of melanocortins.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the brain but not in the melanoma cells.
Database Links

HGNC: 6933

OMIM: 600042

KEGG: hsa:4161

STRING: 9606.ENSP00000318077

UniGene: Hs.248145

Related Products

MC5R Antibodies

MC5R Antibodies for Human

MC5R Antibodies for Homo sapiens (Human)

MC5R Proteins

MC5R Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.