Recombinant Human Melanopsin (OPN4)

Code CSB-CF883398HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
OPN4; MOP; Melanopsin; Opsin-4
Species
Homo sapiens (Human)
Expression Region
1-478
Target Protein Sequence
MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPL PTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMS FTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFG VASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLC CFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLL VILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVA IAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGW THMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Photoreceptor that binds cis-retinaldehydes. Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light. May be involved in the optokinetic visual tracking response. May be involved in the regulation of retinal hyaloid vessel growth and regression.
Gene References into Functions
  1. Valuable insight into the structure-function relationships of human melanopsin, including several key functional residues of the melanopsin protein. The identification of melanopsin variants with significantly altered function may serve to detect individuals with disrupted melanopsin-based light perception, and potentially highlight those at increased risk of sleep disturbance, circadian dysfunction, and visual disorders. PMID: 29700553
  2. The wide distribution of OPN4 in central areas of the human brain evokes a question whether ambient light has important straight targets in the human brain outside the retinohypothalamic tract. PMID: 27690288
  3. Trait-like individual differences in the melanopsin phototransduction circuitry contribute to individual differences in sleep timing. Blue light-sensitive young individuals are more prone to delayed sleep. PMID: 27091519
  4. The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance. PMID: 24909488
  5. By broadening the tuning of intrinsically photosensitive retinal ganglion cells, melanopsin tristability produces signal integration. PMID: 25741728
  6. The response of the human pupil to the separate stimulation of the cones and melanopsin at a range of temporal frequencies under photopic conditions, was measured. PMID: 25313040
  7. Studied OPN4*Ile394Thr gene polymorphism in association with sleep/wake timing. PMID: 24887407
  8. The results of this study showed that the post illumination pupil response varied on the basis of OPN4 I394T genotype among individuals with seasonal affective disorder. PMID: 23809464
  9. Studied the association between melanopsin gene polymorphism and pupillary light reflex under diverse photic conditions, including different intensities and wavelengths. PMID: 24119231
  10. A comparison of melanopsin with the mechanisms documented for vertebrate (bovine) and invertebrate (squid) visual photoreceptors shows that such a mechanism is not affected by the diversity of the three chromophore cavities. PMID: 24449866
  11. Significant interaction between the genotype of I394T (TT versus TC+CC) and luminance levels was found in pupil size. PMID: 23555953
  12. An action spectrum for the calcium response in cells expressing human melanopsin had the predicted form for an opsin : vitamin A1 pigment and peaked at 479 nm. The G-protein selectivity and spectral sensitivity of human melanopsin is similar to that previously described for rodents. PMID: 23554393
  13. the results indicate that ectopic expression of human OPN4 in orexin neurons enables long-lasting activation of orexin neurons by blue light to control sleep/wakefulness of the mice. PMID: 22868039
  14. These results suggest that the P10L TT genotype of melanopsin interacts with daylength to predispose individuals to vary in sleep onset and chronotype as a function of daylength. PMID: 22881342
  15. The relative contribution of melanopsin and visual photoreceptors are assessed by comparing pupillary light reflex responses in a totally visually blind patient with normally sighted individuals. PMID: 23055493
  16. Melanopsin and mechanisms of non-visual ocular photoreception PMID: 22074930
  17. The recent advances in the emerging roles of melanopsin and intrinsically photosensitive retinal ganglion cells, are reviewed. PMID: 20810319
  18. melanopsin acts as a sensory photopigment, coupled to a native ion channel via a G-protein signalling cascade, to drive physiological light detection PMID: 15674244
  19. an anatomically distinct population of 'giant', melanopsin-expressing ganglion cells in the primate retina that, in addition to being intrinsically photosensitive, are strongly activated by rods and cones PMID: 15716953
  20. Regulation of melanopsin expression [review] PMID: 16687290
  21. HEK293 cells stably expressing melanopsin have proven to be a useful tool to study melanopsin-initiated signaling. PMID: 16961436
  22. Data show that Seasonal Affective Disorder participants have a higher frequency of the melanopsin (OPN4) homozygous minor genotype (T/T) for the missense variant rs2675703 (P10L) than controls, compared to the combined frequencies of C/C and C/T. PMID: 18804284

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell projection, dendrite. Perikaryon.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity
Expressed in the retina.
Database Links

HGNC: 14449

OMIM: 606665

KEGG: hsa:94233

STRING: 9606.ENSP00000361141

UniGene: Hs.283922

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1