Recombinant Human Melatonin receptor type 1B (MTNR1B)

Code CSB-CF015190HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
MTNR1B; Melatonin receptor type 1B; Mel-1B-R; Mel1b receptor
Species
Homo sapiens (Human)
Expression Region
1-362
Target Protein Sequence
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD AL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for melatonin. Likely to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
Gene References into Functions
  1. Genome-wide significant (P < 5 x 10(-8) ) interaction with MTNR1B and joint effects were detected for CMIP intronic rs17197883. PMID: 29691896
  2. The reduced titer of melatonin, along with altered fasting blood glucose due to MTNR1B genetic variant, acts as a risk factor towards type 2 diabetes in the Gujarat population of India. PMID: 29674279
  3. that MTNR1B and IRS2 gene variants impacted epicardial fat thickness, lipid profile and glucose homeostasis PMID: 28708046
  4. melatonin stimulates PINK1 expression via an MT2 /Akt/NF-kappaB pathway, and such stimulation is important for the prevention of neuronal cell apoptosis under high glucose conditions. PMID: 28580603
  5. MTNR1B rs10830963 polymorphism is associated with gestational diabetes susceptibility, and women with a higher number of G alleles have an increased risk of gestational diabetes development. PMID: 28084098
  6. In women with psychosis, troponin T levels were associated with genetic variants in MTNR1B. PMID: 28167435
  7. The present data suggested that MTNR1B polymorphisms could influence the clinical features in lupus patients, and especially the susceptibility to leucopenia PMID: 27115109
  8. MTNR1B rs10830963/G variant is associated with gestational diabetes binary and glycemic traits in the Caucasian case-control study. PMID: 28072873
  9. the risk allele (G allele) of rs10830963 and (T allele) of rs1387153 in MTNR1B lead to a higher risk for gestational diabetes mellitus PMID: 26563312
  10. Our results provide the surprising insight that the MTNR1B risk allele influences dynamics of melatonin secretion, generating a novel hypothesis that the MTNR1B risk allele may extend the duration of endogenous melatonin production later into the morning and that early waking may magnify the diabetes risk conferred by the risk allele. PMID: 26868293
  11. Insomnia does not mediate or modify the association between MTNR1B risk variant rs10830963 and glucose levels. PMID: 26912228
  12. finding suggests that the MTNR1B-dependent vulnerability for elevated fasting plasma glucose levels is shared between bipolar disorder and schizophrenia PMID: 26991397
  13. For the first time, we show that Cry 2 rs2292910 and MTNR1B rs3781638 are associated with osteoporosis in a Chinese geriatric cohort. PMID: 26564225
  14. rs10830963 polymorphism was not associated with polycystic ovary syndrome in Han Chinese. PMID: 26519818
  15. Authors investigated the association between rs4753426 single nucleotide polymorphisms in the melatonin receptor 1B (MTNR1B) gene and the risk of developing gestational diabetes mellitus (GDM). PMID: 26345809
  16. Increases in islet MTNR1B expression is associated with type 2 diabetes susceptibility. PMID: 26551672
  17. This systematic review was a comprehensive analysis of the currently available evidence, and found an overall significant association of rs4753426 polymorphism with the risk of--{REVIEW} PMID: 26431121
  18. results indicate, for the first time, the presence of a functional circadian clock in the human myometrium with the hMTNR1B gene as a clock controlled target. PMID: 25939854
  19. MTNR1B rs4753426 and MTNR1B rs10830963 polymorphisms are not obviously associated with risk of AIS in either Asian populations or Caucasian populations. PMID: 25898821
  20. rs10830963 MTNR1B polymorphism could be associated with individual differences in weight loss induced by a hypocaloric diet PMID: 25870980
  21. MTNR1B rs10830963 risk variant worsens the effect of melatonin on glucose tolerance PMID: 26440713
  22. these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis. PMID: 25707907
  23. It has been shown for the first time in obese youth that the MTNR1B variant is associated with an increased risk of IFG PMID: 25919927
  24. our study found that the genetic polymorphisms rs10830963 and rs1387153 in MTNR1B and rs1801278 in IRS1 were associated with an increased risk of developing GDM. PMID: 25146448
  25. Carriers of the G allele of MTNR1B rs10830963 are more likely to develop gestational diabetes than carriers of the C allele. PMID: 25982863
  26. results obtained are suggestive of MTNR1B role in T2D etiology, they need to be confirmed with much larger sample sizes PMID: 25922310
  27. cross-talk mediated via physical association of melatonin MT2 and 5-HT2C receptors into functional heteromers PMID: 25770211
  28. The extent of receptor internalization for the human MT2 receptor is independent of the intrinsic efficacy of agonists and provide novel insights into the controversial relationship between intrinsic agonist efficacy and agonist-induced internalization PMID: 25059758
  29. the association between the common MTNR1B rs10830963 variation and fasting plasma glucose levels in BH population. PMID: 24710643
  30. We conclude that variation in MTNR1B contributes to the absolute level of insulin secretion but not to differences in the temporal rate of change in insulin secretion. PMID: 24728128
  31. High expression for MT2 receptor is associated with gastric adenocarcinoma. PMID: 24142542
  32. 14 mutants with loss of Gi protein activation that associate with increased risk of type 2 diabete development (Review) PMID: 23798576
  33. Genetics of MTNR1B point to impact of the melatonin signalling pathway for BP and left ventricular function. PMID: 23611530
  34. GCKR rs780094 variant confers high cross-ethnicity risk for the development of T2DM, while significant associations between GCK, MTNR1B and G6PC2 variants and T2DM risk are limited to Caucasians. PMID: 23840762
  35. Our data indicate that variants in the circadian-related genes CRY2 and MTNR1B may affect long-term changes in energy expenditure, and dietary fat intake may modify the genetic effects. PMID: 24335056
  36. genetic association study in women in Finland: Data suggest that 2 SNPs in MTNR1B (rs10830963; rs1387153) are associated with gestational diabetes (and type 2 diabetes, as shown in previous studies); down-regulation of insulin secretion is related. PMID: 23761423
  37. The rs10830963 MTNR1B polymorphism is a risk factor for developing impaired glucose regulation and type 2 diabetes mellitus. (Meta-analysis) PMID: 23226241
  38. There is a strong association of rs1374645 polymorphism with low fasting blood glucose levels in the low BMI group compared to the high BMI group. PMID: 21558052
  39. Investigated whether genetic variants in MTNR1B were associated with delirium; none of the 5 single nucleotide polymorphisms tested were found to be associated with the occurrence of delirium. PMID: 22759724
  40. The MTNR1B is likely to be involved in the regulation of glucose homeostasis during pregnancy. PMID: 22768333
  41. These data showing the association of polymorphisms in the TPH2 and MTNR1B genes with the progressive subtypes of multiple sclerosis and disability suggest dysregulation in melatonin pathway PMID: 22698518
  42. This study confirms the association of gestational diabetes mellitus with the rs10830963 variant in a sample of the Greek population. PMID: 22450346
  43. Rare MTNR1B variants impairing melatonin receptor 1B function contribute to type 2 diabetes. PMID: 22286214
  44. Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women. PMID: 22096510
  45. The results of this study suggested that the Single nucleotide polymorphisms MT(2) receptor gene influence the risk of recurrent depressive disorder. PMID: 21353709
  46. The rs10830963 polymorphism in MTNR1B was associated with increased fasting glucose and risk of impaired fasting glucose in Chinese children and adolescents. PMID: 21701235
  47. The G-allele of rs10830693 in the MTNR1B gene was significantly related to glucose levels, while an impact of this genetic variant on the changes in glucose metabolism in children participating in a lifestyle intervention was not observable. PMID: 21366812
  48. There is no effect by the common gene variant rs10830963 of the melatonin receptor 1B on the association between sleep disturbances and type 2 diabetes. PMID: 21380592
  49. There were significant associations between the two genetic variants (rs10830963 and rs1387153) of the melatonin receptor 1B gene and gestational diabetes mellitus. PMID: 21658282
  50. The rs3781637 A/G polymorphism of the MTNR1B gene is associated with type 2 diabetes, plasma, total cholesterol and LDL-C levels in the Han Chinese population. PMID: 21470412

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in retina and less in brain and hippocampus.
Database Links

HGNC: 7464

OMIM: 600804

KEGG: hsa:4544

STRING: 9606.ENSP00000257068

UniGene: Hs.569039

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1