Recombinant Human Melatonin-related receptor (GPR50)

Code CSB-CF622668HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
GPR50
Uniprot No.
Alternative Names
GPR50; Melatonin-related receptor; G protein-coupled receptor 50; H9
Species
Homo sapiens (Human)
Expression Region
1-617
Target Protein Sequence
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY HDVVVIDVEDDPDEMAV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Does not bind melatonin.
Gene References into Functions
  1. GPR50 is a TbetaRI co-receptor with potential impact on cancer development PMID: 29572483
  2. Pre-eclampsia (PE) plasma IgG1 anti-Epstein-Barr virus nuclear antigen 1 (EBNA-1) antibody cross-reacts with placental protein G protein-coupled receptor 50 (GPR50). PMID: 27181993
  3. The results provide deeper insight into the functional evolution of GPR50 in mammals at the molecular level PMID: 25730005
  4. There was only weak female-specific association between GPR50 variants in late-life depression. No significant associations were observed in men. PMID: 25798330
  5. study found an association between Seasonal Affective Disorder (SAD) and a single nucleotide polymorphism (intronic rs2072621) of the gene encoding GPR50 in females. PMID: 21565467
  6. Positive expression of melatonin receptor can be found in human hypertrophic scar and normal skin, but it is higher in scar. PMID: 20737950
  7. we found 2 polymorphisms in the GPR50 receptor of patients with adolescent idiopathic scoliosis, but they were not present at a highly significant frequency when compared with controls PMID: 20733416
  8. Antibodies were used to study the expression of GPR50 in mouse, rat and human hypothalamus.GPR50 immunoreactivity (ir) was observed in dorsomedial hypothalamic (DMH) cells and in cells of the ependymal layer of the third ventricle of the hypothalamus. PMID: 20210849
  9. This is the first association of rs1202874 with BD and is the second positive association at the GPR50 locus. PMID: 20371266
  10. Results identify neurite outgrowth inhibitor NOGO-A as an interacting partner of GPR50 and found an enrichment of both Gpr50 and neuronal Nogo-A at the synapse. PMID: 19699797
  11. Polymorphisms in GPR50 were compared in bipolar affective disorder (BD), major depressive disorder (MDD), schizophrenia (SCZ) and controls. GPR50(Delta502-505) or a variant is a sex-specific risk factor for susceptibility to BD and SCZ. PMID: 15452587
  12. Results describe sequence variants in the melatonin-related receptor gene (GPR50) that associate with circulating triglyceride and HDL levels. PMID: 16436372
  13. GPR50, an orphan GPCR, heterodimerizes constitutively and specifically with MT(1) and MT(2) melatonin receptors PMID: 16778767
  14. No evidence for an association for this gene with mood disorders in a Hungarian population. PMID: 18075476

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Hypothalamus and pituitary.
Database Links

HGNC: 4506

OMIM: 300207

KEGG: hsa:9248

STRING: 9606.ENSP00000218316

UniGene: Hs.567390

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1